Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR10Z1 Olfactory Receptor

Gene Symbol OR10Z11 (View this gene in GeneCards)
Family 10
Subfamily Z
Pseudogene No
CORP pseudogene probability score 0.15 (functional)
Aliases OR1-15, HsOR1.4.10, ORL3004
External Ids HGNC: 14996   GeneBank: AB065635, BK004195, NM_001004478   ORDB: ORL3004   
Build #39 labels OR10Z1
Chromosomal location 1:158,606,439-158,607,377 (+)
Cluster 1@159a
Synteny CLIC#4
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10R2 54.22% 308
OR10R3P 54.87% 308
OR10T1P 52.58% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10Z1 89% 313
Chimp CONTIG*********** 99% 313
Mouse Or10z1 88% 313
Rat Or10z1 86% 313
Cow OR10Z1 86% 313

Expression evidences

Source Accession
mRNA AB529288
GNF Atlas2 gnf1h01972_at

Sequence information

Nucleotide sequence ATGGGGCAGACCAACGTAACCTCCTGGAGGGATTTTGTCTTCCTGGGCTTCTCCAGTTCT
GGGGAGTTGCAGCTCCTTCTCTTTGCCTTGTTCCTCTCTCTGTATCTAGTCACTCTGACC
AGCAATGTCTTCATTATCATAGCCATCAGGCTGGATAGCCATCTGCACACCCCCATGTAC
CTCTTCCTTTCCTTCCTATCCTTCTCTGAGACCTGCTACACTTTGGGCATCATCCCTAGA
ATGCTCTCTGGCCTGGCTGGGGGGGACCAGGCTATCTCCTATGTGGGCTGTGCTGCCCAG
ATGTTCTTTTCTGCCTCATGGGCCTGTACTAACTGCTTCCTTCTGGCTGCCATGGGCTTT
GACAGATATGTGGCCATCTGTGCTCCACTCCACTATGCCAGCCACATGAATCCTACCCTC
TGTGCCCAGCTGGTCATTACTTCCTTCCTGACTGGATACCTCTTTGGACTGGGAATGACA
CTAGTTATTTTCCACCTCTCATTCTGCAGCTCCCATGAAATCCAGCACTTTTTTTGTGAC
ACGCCACCTGTGCTGAGCCTAGCCTGTGGAGATACAGGCCCGAGTGAGCTGAGGATCTTT
ATCCTCAGTCTTTTGGTCCTCTTGGTCTCCTTCTTCTTCATCACCATCTCCTACGCCTAC
ATCTTGGCAGCAATACTGAGGATCCCCTCTGCTGAGGGGCAGAAGAAGGCCTTCTCCACT
TGTGCCTCGCACCTTACAGTGGTCATTATTCATTATGGCTGTGCTTCCTTCGTGTACCTG
AGGCCCAAAGCCAGCTACTCTCTTGAGAGAGATCAGCTTATTGCCATGACCTATACTGTA
GTGACCCCCCTCCTTAATCCCATTGTTTATAGTCTAAGGAATAGGGCTATACAGACAGCT
CTGAGGAATGCTTTCAGAGGGAGATTGCTGGGTAAAGGA
Conceptual translation MGQTNVTSWRDFVFLGFSSSGELQLLLFALFLSLYLVTLTSNVFIIIAIRLDSHLHTPMY
LFLSFLSFSETCYTLGIIPRMLSGLAGGDQAISYVGCAAQMFFSASWACTNCFLLAAMGF
DRYVAICAPLHYASHMNPTLCAQLVITSFLTGYLFGLGMTLVIFHLSFCSSHEIQHFFCD
TPPVLSLACGDTGPSELRIFILSLLVLLVSFFFITISYAYILAAILRIPSAEGQKKAFST
CASHLTVVIIHYGCASFVYLRPKASYSLERDQLIAMTYTVVTPLLNPIVYSLRNRAIQTA
LRNAFRGRLLGKG

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS C/A H/N 1000GP (YRI, YRI, YRI)
1 100 -100 SYN / G/G 1000GP (YRI)
1 158,576,712 158,576,712 NS G/T V/F rs28565358 (DbSNP)
1 158,576,973 158,576,973 NS A/G I/V rs41273513 (DbSNP)
1 158,577,109 158,577,109 NS A/C N/T rs857685 (DbSNP)
1 158,577,167 158,577,167 SYN A/T G/G rs2427808 (DbSNP)
1 158,607,183 158,607,183 NS A/G I/V 1000GP (CEU)
1 158,607,319 158,607,319 NS A/C N/T 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

H56N L82F G87V Y153* V162F I249V N294T % Freq CORP
1 H L G Y V I N 70.05 0.253
2 H L G Y V I T 23.81 0.253
3 H F G Y V I N 2.84 0.203
4 H L G * V I N 1.54 1.200
5 H L G Y V V N 0.77 0.253
6 H L G Y F I N 0.46 0.253
7 N L G Y V I N 0.38 0.253
8 H L G Y V V T 0.08 0.253
9 H L V Y V I N 0.08 0.253

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR10Z1.aApr07-unspliced main_exon CDS chr1 158,606,439 158,607,377 +
3UTR chr1 158,607,377 158,607,380 +