Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11A1 Olfactory Receptor

Gene Symbol OR11A11 (View this gene in GeneCards)
Family 11
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases hs6M1-18, AC004174-A, dJ994E9.6, OR6-30, HsOR6.3.21, ORL524
External Ids HGNC: 8176   GeneBank: BK004208, HSA302614-HSA302623   ORDB: ORL524   
Build #39 labels OR11A1
Chromosomal location 6:29,426,697-29,427,641 (-)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10U1P 45.33% 300
OR11I1P 47.73% 308
OR6B2 45.7% 302

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11I1 52% 311
Chimp CONTIG*********** 96% 315
Mouse Or11a4 75% 312
Rat Or11a4 74% 312
Cow OR11A1 82% 315

Expression evidences

Source Accession
ESTs AA936177
mRNA BC131608
GNF Atlas2 221343_at

Sequence information

Nucleotide sequence ATGGAAATTGTCTCCACAGGAAACGAAACTATTACTGAATTTGTCCTCCTTGGCTTCTAT
GACATCCCTGAACTGCATTTCTTGTTTTTTATTGTATTCACTGCTGTCTATGTCTTCATC
ATCATAGGGAATATGCTGATTATTGTAGCAGTGGTTAGCTCCCAGAGGCTCCACAAACCC
ATGTATATTTTCTTGGCGAATCTGTCCTTCCTGGATATTCTCTACACCTCCGCAGTGATG
CCAAAAATGCTGGAGGGCTTCCTGCAAGAAGCAACTATCTCTGTGGCTGGTTGCTTGCTC
CAGTTCTTTATCTTCGGCTCTCTAGCCACAGCTGAATGCTTACTGCTGGCTGTCATGGCA
TATGACCGCTACCTGGCAATTTGCTACCCACTCCACTACCCACTCCTGATGGGGCCCAGA
CGGTACATGGGGCTGGTGGTCACAACCTGGCTCTCTGGATTTGTGGTAGATGGACTGGTT
GTGGCCCTGGTGGCCCAGCTGAGGTTCTGTGGCCCCAACCACATTGACCAGTTTTACTGT
GACTTTATGCTTTTCGTGGGCCTGGCTTGCTCGGATCCCAGAGTGGCTCAGGTGACAACT
CTCATTCTGTCTGTGTTCTGCCTCACTATTCCTTTTGGACTGATTCTGACATCTTATGCC
AGAATTGTGGTGGCAGTGCTGAGAGTTCCTGCTGGGGCAAGCAGGAGAAGGGCTTTCTCC
ACATGCTCCTCCCACCTAGCTGTAGTGACCACATTCTATGGAACGCTCATGATCTTTTAT
GTTGCACCCTCTGCTGTCCATTCCCAGCTCCTCTCCAAGGTCTTCTCCCTGCTCTACACT
GTGGTCACCCCTCTCTTCAATCCTGTGATCTATACCATGAGGAACAAGGAGGTGCATCAG
GCACTTCGGAAGATTCTCTGTATCAAACAAACTGAAACACTTGAT
Conceptual translation MEIVSTGNETITEFVLLGFYDIPELHFLFFIVFTAVYVFIIIGNMLIIVAVVSSQRLHKP
MYIFLANLSFLDILYTSAVMPKMLEGFLQEATISVAGCLLQFFIFGSLATAECLLLAVMA
YDRYLAICYPLHYPLLMGPRRYMGLVVTTWLSGFVVDGLVVALVAQLRFCGPNHIDQFYC
DFMLFVGLACSDPRVAQVTTLILSVFCLTIPFGLILTSYARIVVAVLRVPAGASRRRAFS
TCSSHLAVVTTFYGTLMIFYVAPSAVHSQLLSKVFSLLYTVVTPLFNPVIYTMRNKEVHQ
ALRKILCIKQTETLD

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 NS C/T A/T 1000GP (YRI, YRI, YRI)
6 100 -100 SYN G/A F/F 1000GP (YRI)
6 29,394,889 29,394,889 NS T/C Q/R rs61742822 (DbSNP)
6 29,394,926 29,394,926 NS C/T A/T rs9257857 (DbSNP)
6 29,395,044 29,395,044 SYN C/T L/L rs62408574 (DbSNP)
6 29,395,057 29,395,057 NS C/T C/Y rs16894898 (DbSNP)
6 29,395,104 29,395,104 SYN A/G F/F rs16894899 (DbSNP)
6 29,395,180 29,395,180 NS G/A T/M rs61978565 (DbSNP)
6 29,427,149 29,427,149 NS C/T A/T 1000GP (CEU, CHBJPT)
6 29,427,280 29,427,280 NS T/C Y/C 1000GP (CHBJPT)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 4 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A165T D157A Y121C M80T % Freq CORP
1 A D Y M 81.64 0.096
2 T D Y M 10.06 0.096
3 A D Y T 4.76 0.096
4 A D C M 3.46 0.096
5 A A Y M 0.08 0.096

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR11A1andOR5V1.aApr07 main_exon 3UTR chr6 29,425,504 29,426,697 -
CDS chr6 29,426,697 29,427,641 -
5UTR chr6 29,427,641 29,427,732 -
exon_5UTR chr6 29,428,913 29,428,960 -
exon_5UTR chr6 29,430,301 29,430,425 -
exon_5UTR chr6 29,431,864 29,431,987 -
exon_5UTR chr6 29,456,987 29,457,071 -