Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11G2 Olfactory Receptor

Gene Symbol OR11G21 (View this gene in GeneCards)
Family 11
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR14-34, HsOR14.1.25, ORL3687
External Ids HGNC: 15346   GeneBank: AB065897, AF399610, BK004453, NM_001005503   ORDB: ORL3687   
Build #39 labels OR11G2
Chromosomal location 14:20,197,438-20,198,370 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11G1P 80.07% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11G2 83% 310
Dog OR11G2B 80% 311
Chimp CONTIG794.41-535 98% 311
Mouse Or11g2 82% 307
Rat Or11g1 80% 307
Rat Or11g2 80% 300
Cow OR11G2 84% 308
Cow OR11G2C 83% 308

Expression evidences

Source Accession
mRNA AB463954
GNF Atlas2 gnf1h02178_at

Sequence information

Nucleotide sequence ATGAAAATCTTCAACAGCCCCAGCAACTCCAGCACCTTCACTGGCTTCATCCTCCTGGGC
TTCCCTTGCCCCAGGGAGGGGCAGATCCTCCTCTTTGTGCTCTTCACTGTTGTTTACCTC
CTGACCCTCATGGGCAATGGTTCCATCATCTGTGCTGTGCACTGGGATCAGAGACTCCAC
GCCCCCATGTACATCCTGCTCGCCAACTTCTCCTTCTTGGAGATATGTTATGTCACCTCC
ACAGTCCCCAGCATGCTGGCCAACTTCCTCTCTGACACCAAGATCATCTCGTTCTCTGGC
TGCTTCCTCCAGTTCTACTTTTTCTTCTCCTTGGGCTCTACAGAATGCTTTTTCCTGGCA
GTTATGGCATTTGATCGATACCTTGCCATCTGTCGGCCTCTACGCTATCCAACCATTATG
ACCAGACGTCTCTGTACCAATCTTGTGGTCAATTGCTGGGTACTTGGTTTCATCTGGTTC
TTGATTCCTATCGTCAACATCTCCCAAATGTCCTTCTGTGGATCTAGGATTATTGACCAC
TTCCTATGTGACCCAGCTCCTCTTCTAACTCTCACTTGCAAAAAAGGCCCTGTGATAGAG
CTTGTCTTTTCTGTCTTAAGTCCTCTGCCTGTCTTTATGCTCTTTCTCTTCATTGTGGGG
TCCTATGCTCTGGTCGTGAGAGCTGTGTTGAGGGTCCCTTCAGCAGCTGGGAGAAGAAAG
GCTTTCTCCACCTGTGGGTCTCACCTGGCTGTGGTTTCACTGTTCTACGGCTCAGTACTG
GTCATGTATGGGAGCCCACCATCTAAGAATGAAGCTGGAAAGCAGAAGACTGTGACTCTG
TTTTATTCTGTTGTTACCCCACTGCTTAACCCTGTGATATATAGTCTTAGGAACAAAGAT
ATGAGAAAAGCTCTGAAGAAATTTTGGGGAACA
Conceptual translation MKIFNSPSNSSTFTGFILLGFPCPREGQILLFVLFTVVYLLTLMGNGSIICAVHWDQRLH
APMYILLANFSFLEICYVTSTVPSMLANFLSDTKIISFSGCFLQFYFFFSLGSTECFFLA
VMAFDRYLAICRPLRYPTIMTRRLCTNLVVNCWVLGFIWFLIPIVNISQMSFCGSRIIDH
FLCDPAPLLTLTCKKGPVIELVFSVLSPLPVFMLFLFIVGSYALVVRAVLRVPSAAGRRK
AFSTCGSHLAVVSLFYGSVLVMYGSPPSKNEAGKQKTVTLFYSVVTPLLNPVIYSLRNKD
MRKALKKFWGT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 nonsense SNP C/A C/* 1000GP (YRI)
14 100 -100 NS T/A I/N 1000GP (YRI, YRI, YRI, YRI)
14 100 -100 SYN G/C S/S 1000GP (YRI)
14 20,197,631 20,197,631 NS T/A I/N 1000GP (CEU, CHBJPT)
14 20,197,681 20,197,681 NS G/A V/I 1000GP (CEU, CHBJPT)
14 20,197,728 20,197,728 SYN G/C S/S 1000GP (CEU, CHBJPT)
14 20,665,627 20,665,627 NS A/G S/G rs45620333 (DbSNP)
14 20,665,790 20,665,790 NS A/T N/I rs4981822 (DbSNP)
14 20,665,840 20,665,840 NS A/G I/V rs4981088 (DbSNP)
14 20,665,887 20,665,887 SYN C/G S/S rs4981823 (DbSNP)
14 20,665,908 20,665,907 Ins(1) -/A rs61106173 (DbSNP)
14 20,666,177 20,666,176 Ins(1) -/A rs67847713 (DbSNP)
14 20,666,182 20,666,181 Ins(1) -/A rs55781225 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S45G G49D I84N I99N V116I K128N V183M V232M % Freq CORP
1 S G I I V K V V 48.69 0.222
2 S G I N I K V V 43.39 0.222
3 S G I N I N M V 3.76 0.222
4 G D I I V K V V 2.07 0.222
5 S G I I I K V V 1.00 0.222
6 S G I I V K M V 0.31 0.222
7 S G I N V K V V 0.23 0.222
8 S G I I I N M V 0.15 0.222
9 S G I I V N M V 0.08 0.222
10 S D I I V K V V 0.08 0.222
11 S G N N I K V V 0.08 0.222
12 S G N I V K V V 0.08 0.222
13 S G I I V K V M 0.08 0.222

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR11G2.aApr07-unspliced main_exon 5UTR chr14 20,197,336 20,197,438 +
CDS chr14 20,197,438 20,198,370 +
3UTR chr14 20,198,370 20,198,373 +