Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11H1 Olfactory Receptor

Gene Symbol OR11H11 (View this gene in GeneCards)
Family 11
Subfamily H
Pseudogene No
CORP pseudogene probability score
Aliases OR22-1, HsOR22.1.1, ORL3802
External Ids HGNC: 15404   GeneBank: AB065933, AF399611, BK004492, NM_001005239, XM_495967   ORDB: ORL3802   
Build #39 labels OR11H1
Chromosomal location 22:15,528,191-15,529,135 (-)
Cluster 22@16
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11H2 98.41% 315

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11H12 83% 310
Chimp CONTIG3485.9-6200 97% 315
Chimp CONTIG1691.16-4747 92% 315
Mouse Or11h6 65% 298
Rat Or11j4 63% 302
Cow OR11H12 83% 315
Cow OR11H12B 82% 315

Expression evidences

Source Accession
GNF Atlas2 gnf1h01851_at

Sequence information

Nucleotide sequence ATGAATGTCTCTGAGCCAAATTCCAGCTTTGCTTTTGTAAATGAATTTATACTCCAAGGT
TTCTCTTGTGAGTGGACAATTCAGATCTTCCTCTTCTCACTCTTTACTACAACATATGCA
CTGACTATAACAGGGAATGGAGCCATTGCTTTTGTCCTGTGGTGTGACCGGCGACTTCAC
ACTCCCATGTACATGTTCCTGGGAAATTTCTCCTTTTTAGAGATATGGTATGTCTCTTCT
ACAGTTCCCAAGATGTTGGTCAACTTCCTTTCAGAGAAAAAAAACATCTCCTTTGCTGGA
TGTTTTCTCCAGTTTTATTTCTTCTTCTCTTTGGGTACATCAGAATGCTTGCTTTTGACT
GTGATGGCCTTTGATCAGTACCTTGCTATCTGCCGTCCCTTGCTCTATCCTAATATCATG
ACTGGGCATCTCTATGCCAAACTGGTCATACTGTGCTGGGTTTGTGGATTTCTGTGGTTC
CTGATCCCCATTGTTCTCATCTCTCAGATGCCCTTCTGTGGCCCAAACATTATTGACCAT
GTTGTGTGTGACCCAGGGCCACGATTTGCATTGGATTGTGTTTCTGCCCCAAGAATCCAA
CTGTTTTGCTACACTCTAAGCTCATTAGTTATTTTTGGTAACTTCCTCTTTATTATTGGA
TCCTATACTCTTGTCCTGAAAGCTATGTTGGGTATGCCTTCAAGCACTGGGAGACATAAG
GCCTTCTCTACCTGTGGGTCTCATTTGGCTGTGGTATCACTGTGCTATAGCTCTCTTATG
GTCATGTATGTGAGCCCAGGACTCGGACATTCTACAGGGATGCAGAAAATTGAAACTTTG
TTCTATGCTATGGTGACCCCACTCTTCAATCCCCTTATCTATAGCCTCCAGAATAAGGAG
ATAAAGGCAGCCCTGAGGAAAGTTCTGGGGAGTTCCAACATAATC
Conceptual translation MNVSEPNSSFAFVNEFILQGFSCEWTIQIFLFSLFTTTYALTITGNGAIAFVLWCDRRLH
TPMYMFLGNFSFLEIWYVSSTVPKMLVNFLSEKKNISFAGCFLQFYFFFSLGTSECLLLT
VMAFDQYLAICRPLLYPNIMTGHLYAKLVILCWVCGFLWFLIPIVLISQMPFCGPNIIDH
VVCDPGPRFALDCVSAPRIQLFCYTLSSLVIFGNFLFIIGSYTLVLKAMLGMPSSTGRHK
AFSTCGSHLAVVSLCYSSLMVMYVSPGLGHSTGMQKIETLFYAMVTPLFNPLIYSLQNKE
IKAALRKVLGSSNII

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
CopyNumber 51 (Hasin)
22 16,053,758 17,300,320 CopyNumber Variation_8898 (DGV)
22 16,053,758 17,524,203 CopyNumber Variation_34559 (DGV)
22 16,055,421 16,467,142 CopyNumber Variation_32445 (DGV)
22 16,081,115 17,057,138 CopyNumber Variation_3236 (DGV)
22 16,085,001 16,463,023 CopyNumber Variation_73671 (DGV)
22 16,124,247 16,504,327 CopyNumber Variation_7329 (DGV)
22 16,129,865 17,277,462 CopyNumber Variation_4115 (DGV)
22 16,257,060 16,459,518 CopyNumber Variation_73672 (DGV)
22 16,346,026 16,461,480 CopyNumber Variation_79403 (DGV), Variation_90841 (DGV)
22 16,367,425 16,572,669 CopyNumber Variation_5166 (DGV)
22 16,379,229 16,519,909 CopyNumber Variation_0813 (DGV), Variation_2257 (DGV)
22 16,445,003 16,461,480 CopyNumber Variation_79404 (DGV), Variation_90845 (DGV)
22 16,449,063 16,449,265 Del(-11) #29(modil)
22 16,449,384 16,449,455 Del(-9) #30(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR11H1.aApr07-unspliced main_exon 5UTR chr22 15,528,158 15,528,191 -
CDS chr22 15,528,191 15,529,135 -
3UTR chr22 15,529,135 15,529,138 -