Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11H12 Olfactory Receptor

Gene Symbol OR11H121 (View this gene in GeneCards)
Family 11
Subfamily H
Pseudogene No
CORP pseudogene probability score
Aliases
External Ids HGNC: 30738   
Build #39 labels
Chromosomal location 14:18,601,117-18,602,094 (+)
Cluster 14@19
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11H1 98.73% 315
OR11H2 97.78% 315

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11H12 81% 321
Mouse Or11h6 65% 298
Rat Or11j4 64% 302
Cow OR11H12 83% 315
Cow OR11H12B 81% 328

Expression evidences

Source Accession
mRNA BC136731

Sequence information

Nucleotide sequence ATGTGTCCCTTGACCTTGCAGGTCACTGGCCTAATGAATGTCTCTGAGCCAAATTCCAGC
TTTGCTTTTGTAAATGAATTTATACTCCAAGGTTTCACTTGTGAGTGGACAATTCAGATC
TTCCTCTTCTCACTCTTTACTACAACATATGCACTGACTATAACAGGGAATGGAGCCATT
GCTTTTGTCCTGTGGTGTGACTGGCGACTTCACACTCCCATGTACATGTTCCTGGGAAAT
TTCTCCTTTTTAGAGATATGGTATGTCTCTTCTACAGTTCCCAAGATGTTGGTCAACTTC
CTTTCAGAGAAAAAAAACATCTCCTTTGCTGGATGTTTTCTCCAGTTTTATTTCTTCTTC
TCTTTGGGTACATCAGAATGCTTGCTTTTGACTGTGATGGCCTTTGATCAGTACCTTGCT
ATCTGCCGTCCCTTGCTCTATCCTAATATCATGACTGGGCATCTCTGTGCCAAACTGGTC
ATACTGTGCTGGGTTTGTGGATTTCTGTGGTTCCTGATCCCCATTGTTCTCATCTCTCAG
ATGCCCTTCTGTGGCCCAAACATTATTGACCATGTTGTGTGTGACCCAGGGCCACGATTT
GCATTGGATTGTGTTTCTGCCCCAAGAATCCAACTGTTTTGCTACACTCTAAGCTCATTA
GTTATTTTTGGTAACTTCCTCTTTATTATTGGATCCTATACTCTTGTCCTGAAAGCTGTG
TTGGGTATGCCTTCAAGCACTGGGAGACATAAGGCCTTCTCTACCTGTGGGTCTCATTTG
GCTGTGGTATCACTGTGCTATAGCTCTCTTATGGTCATGTATGTGAGCCCAGGACTCGGA
CATTCTACAGGGATGCAGAAAATTGAAACTTTGTTCTATGCTATGGTGACCCCACTCTTC
AATCCCCTTATCTATAGCCTCCAGAATAAGGAGATAAAGGCAGCCCTGAGGAAAGTTCTG
GGAAGTTCCAACATAATC
Conceptual translation MCPLTLQVTGLMNVSEPNSSFAFVNEFILQGFTCEWTIQIFLFSLFTTTYALTITGNGAI
AFVLWCDWRLHTPMYMFLGNFSFLEIWYVSSTVPKMLVNFLSEKKNISFAGCFLQFYFFF
SLGTSECLLLTVMAFDQYLAICRPLLYPNIMTGHLCAKLVILCWVCGFLWFLIPIVLISQ
MPFCGPNIIDHVVCDPGPRFALDCVSAPRIQLFCYTLSSLVIFGNFLFIIGSYTLVLKAV
LGMPSSTGRHKAFSTCGSHLAVVSLCYSSLMVMYVSPGLGHSTGMQKIETLFYAMVTPLF
NPLIYSLQNKEIKAALRKVLGSSNII

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
14 19,117,183 20,424,605 CopyNumber Variation_7028 (DGV)
14 19,360,239 20,424,604 CopyNumber Variation_31953 (DGV)
14 19,349,922 20,424,856 CopyNumber Variation_58655 (DGV)
14 19,361,827 19,757,851 CopyNumber Variation_71830 (DGV)
14 19,366,347 19,553,358 CopyNumber Variation_71837 (DGV)
14 19,356,947 19,496,254 CopyNumber Variation_76530 (DGV), Variation_87085 (DGV)
CopyNumber 21 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR11H12.aApr07-unspliced main_exon CDS chr14 18,601,117 18,602,094 +
3UTR chr14 18,602,094 18,602,097 +