Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11H2 Olfactory Receptor

Gene Symbol OR11H21 (View this gene in GeneCards)
Family 11
Subfamily H
Pseudogene No
CORP pseudogene probability score 0.3 (functional)
Aliases OR14-1, HsOR14.1.1
External Ids HGNC: 14716   GeneBank: AB065607, BK004489, NG_002568, NG_004141   
Build #39 labels OR11H2P
Chromosomal location 14:19,712,939-19,713,883 (-)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11H1 98.41% 315

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11H12 82% 310
Chimp CONTIG3485.9-6200 96% 315
Chimp CONTIG1691.16-4747 92% 315
Mouse Or11h6 66% 298
Rat Or11j4 64% 302
Cow OR11H12 83% 315
Cow OR11H12B 82% 315

Sequence information

Nucleotide sequence ATGAATGTCTCTGAGCCAAATTCCAGCTTTGCTTTTGTAAATGAATTTATACTCCAAGGT
TTCTCTTGTGAGTGGACAATTCAGATCTTCCTCTTCTCACTCTTTACTACAATATATGCA
CTGACTATAACAGGGAATGGAGCCATTGCTTTTGTCCTGTGGTGTGACCGGCGACTTCAC
ACTCCCATGTACATGTTCCTGGGAAATTTCTCCTTTTTAGAGATATGGTATGTCTCTTCT
ACAGTTCCCAAGATGTTGGTCAACTTCCTTTCAGAGAAAAAAAACATCTCCTTTGCTGGA
TGTTTTCTCCAGTTTTATTTCTTCTTCTCTTTGGGTACATCAGAATGCTTGCTTTTGACT
GTGATGGCCTTTGATCAGTACCTTGCTATCTGCCGTCCCTTGCTCTATCCTAATATCATG
ACTGGGCATCTCTATGCCAAACTGGTCATACTGTGCTGGGTTTGTGGATTTCTGTGGTTC
CTGATCCCCATTGTTCTCATCTCTCAGAAGCCCTTCTGTGGCCCAAACATTATTGACCAT
GTTGTGTGTGACCCAGGGCCACTATTTGCATTGGATTGTGTTTCTGCCCCAAGAATCCAA
CTGTTTTGCTACACTCTAAGCTCATTAGTTATTTTTGGTAACTTCCTCTTTATTATTGGA
TCCTATACTCTTGTCCTGAAAGCTGTGTTGGGTATGCCTTCAAGCACTGGGAGACATAAG
GCCTTCTCTACCTGTGGGTCTCATTTGGCTGTGGTATCACTGTGCTATAGCCCTCTTATG
GTCATGTATGTGAGCCCAGGACTCGGACATTCTACAGGGATGCAGAAAATTGAAACTTTG
TTCTATGCTATGGTGACCCCACTCTTCAATCCCCTTATCTATAGCCTCCAGAATAAGGAG
ATAAAGGCAGCCCTGAGGAAAGTTCTGGGGAGTTCCAACATAATC
Conceptual translation MNVSEPNSSFAFVNEFILQGFSCEWTIQIFLFSLFTTIYALTITGNGAIAFVLWCDRRLH
TPMYMFLGNFSFLEIWYVSSTVPKMLVNFLSEKKNISFAGCFLQFYFFFSLGTSECLLLT
VMAFDQYLAICRPLLYPNIMTGHLYAKLVILCWVCGFLWFLIPIVLISQKPFCGPNIIDH
VVCDPGPLFALDCVSAPRIQLFCYTLSSLVIFGNFLFIIGSYTLVLKAVLGMPSSTGRHK
AFSTCGSHLAVVSLCYSPLMVMYVSPGLGHSTGMQKIETLFYAMVTPLFNPLIYSLQNKE
IKAALRKVLGSSNII

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 20,181,930 20,181,930 NS A/G I/T rs61979610 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 19,662,531 20,556,187 CopyNumber Variation_3929 (DGV)
14 20,080,166 20,271,356 CopyNumber Variation_4824 (DGV)
14 20,095,109 20,231,601 CopyNumber Variation_4825 (DGV)
14 19,117,183 20,424,605 CopyNumber Variation_7028 (DGV)
14 20,177,234 20,424,604 CopyNumber Variation_30648 (DGV)
14 19,360,239 20,424,604 CopyNumber Variation_31953 (DGV)
14 19,670,757 20,331,117 CopyNumber Variation_37621 (DGV)
14 19,349,922 20,424,856 CopyNumber Variation_58655 (DGV)
14 20,177,210 20,424,753 CopyNumber Variation_66584 (DGV)
14 19,781,170 20,424,776 CopyNumber Variation_71833 (DGV)
14 20,020,589 20,197,401 CopyNumber Variation_71835 (DGV)
14 19,780,325 20,202,019 CopyNumber Variation_71861 (DGV)
14 20,152,622 20,419,574 CopyNumber Variation_76554 (DGV), Variation_87112 (DGV)
14 20,152,622 20,190,758 CopyNumber Variation_87114 (DGV)
14 20,152,622 20,212,550 CopyNumber Variation_87115 (DGV)
14 20,179,862 20,261,582 CopyNumber Variation_87116 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.