Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11H3P Olfactory Receptor

Gene Symbol OR11H3P1 (View this gene in GeneCards)
Family 11
Subfamily H
Pseudogene Yes
CORP pseudogene probability score
Aliases OR15-6, HsOR15.1.4P, ORL3730
External Ids HGNC: 15367   GeneBank: BK004798, NG_004166   ORDB: ORL3730   
Build #39 labels OR11H3P
Chromosomal location 15:22,009,550-22,010,496 (-)
Cluster 15@22
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11H1 91.14% 316
OR11H2 90.82% 316

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11H12 81% 311
Mouse Or11h6 65% 299
Rat Or11j4 62% 303
Cow OR11H12 81% 316
Cow OR11H12B 80% 316
Orang OR11H12 91% 316
Orang OR11H12CP 88% 316
Orang OR11H12D 88% 316
Horse OR11H12 84% 316
Chimp OR11H12FP 97% 316

Expression evidences

Source Accession
ESTs DB051929
mRNA BC062994

Sequence information

Nucleotide sequence ATGAATGTCTCTGAGCCAAATTCCAGCTTTGCTTTAGTAAATGAATTTATACTCCAAGAT
TTATCTTTTGAGTGGACAATTCAGATCTTCCTCTTCTCACTCTTCACTACAACATATGCA
CTGACCATAACAGGAAATGGAGCCATTGCTTGCGCCCTGTGGTGTGACCGGCGACGTCAC
ACTCCCATGTACATGTTCCTGGGAAATTTCTCCTTTTTAGAGATATGGTATGTCTCTTCT
ACAGTTCCCAAGATGTTGGTCAACTTCCTTTCAGAGAAAAAAACCATCTCCTTTGCTGGA
TGTTTTCTCCAATTTTATTTCTTCTTCTCTTTGGGTACATCTGAATGCTTGATTTTGACT
GTGATGGCCTTTGATCAGTACCTTGTTATCTGCCATCCCTTGCACTATCCTAATAAATCA
TGACTGGGCATCTCTGTGCCAAACTGGTCATACTGTGCTGGGTTTGTGGATTTCTGTGTT
TCCTGATCCCCACTGTTCTCATCTCTCAGATGCCCTTCTGTGGTCCAAACATTAATGACC
ATGTTGTGTGTGACCCAGGGCCACTATTTGCATTGGCTTGTGTCTCTGCCCCAAGAATCC
AACTGTTTTGCTACACTCTAAGCTCATTAGTTATTTTTGGTAACTTCCTCTTTATTATTG
GATCCTATACTCTTGTCCTGAAAGCTGTGTTGGGTATGCCTTCGAGCACTGGGAAACATA
AAGCCTTCTCTACCTGTGGGTCTCATTTGGCTGTGGTATCACTGTTCTATGGCTCTCTTA
TGGTCATGTGTGTGAGTCCAGGACTTGGACACTCTATGGGGATGCAGAAAATCAAAACTT
TGTTCTATGCTATGGTGACCCCACTCTTCAATCCCCTTATCTATAGCCTCCAGAATAAGG
AGATAAAGGCAGCCCTGAGGAAAGTTCTGGGGAGTTCCAACATAATC
Conceptual translation MNVSEPNSSFALVNEFILQDLSFEWTIQIFLFSLFTTTYALTITGNGAIACALWCDRRRH
TPMYMFLGNFSFLEIWYVSSTVPKMLVNFLSEKKTISFAGCFLQFYFFFSLGTSECLILT
VMAFDQYLVICHPLHY/XIMTGHLCAKLVILCWVCGFLCFLIPTVLISQMPFCGPNIN
DHVVCDPGPLFALACVSAPRIQLFCYTLSSLVIFGNFLFIIGSYTLVLKAVLGMPSSTGK
HKAFSTCGSHLAVVSLFYGSLMVMCVSPGLGHSMGMQKIKTLFYAMVTPLFNPLIYSLQN
KEIKAALRKVLGSSNII

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
15 22,298,310 22,298,310 SNP A/G rs2808172 (DbSNP)
15 22,298,279 22,298,279 SNP A/G rs11856712 (DbSNP)
15 22,298,024 22,298,024 SNP A/G rs28631648 (DbSNP)
15 22,297,583 22,297,583 SNP A/G rs12438559 (DbSNP)
15 22,297,880 22,297,880 SNP A/G rs11853641 (DbSNP)
15 22,298,333 22,298,333 SNP A/T rs1816290 (DbSNP)
15 22,298,230 22,298,230 SNP A/T rs8036276 (DbSNP)
15 22,297,862 22,297,862 SNP C/G rs8025192 (DbSNP)
15 22,297,514 22,297,514 SNP T/C rs3910009 (DbSNP)
15 22,297,543 22,297,543 SNP T/C rs4454929 (DbSNP)
15 22,298,164 22,298,164 SNP T/G rs1816291 (DbSNP)
15 22,009,911 22,009,911 SNP G/C 1000GP (CEU, CHBJPT)
15 22,009,929 22,009,929 SNP A/G 1000GP (CEU, CHBJPT)
15 22,010,213 22,010,213 SNP G/T 1000GP (CEU, CHBJPT)
15 22,010,328 22,010,328 SNP G/A 1000GP (CEU, CHBJPT)
15 22,010,382 22,010,382 SNP A/T 1000GP (CEU, CHBJPT)
15 22,009,906 22,009,906 SNP G/A 1000GP (CHBJPT)
15 22,009,984 22,009,984 SNP G/A 1000GP (CHBJPT)
15 22,010,359 22,010,359 SNP A/G 1000GP (CHBJPT)
15 100 -100 SNP A/C 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
15 20,266,957 22,674,466 CopyNumber Variation_0318 (DGV)
15 20,610,110 22,575,858 Inversion Variation_0443 (DGV)
15 20,625,544 22,559,977 Inversion Variation_0444 (DGV)
15 20,143,651 23,690,892 CopyNumber Variation_3070 (DGV)
15 20,003,725 23,814,757 CopyNumber Variation_3951 (DGV)
15 20,397,403 22,698,551 CopyNumber Variation_7046 (DGV)
15 20,167,086 22,588,036 CopyNumber Variation_8779 (DGV)
15 20,167,086 22,869,764 CopyNumber Variation_8781 (DGV)
15 20,935,075 22,777,875 CopyNumber Variation_8783 (DGV)
15 20,167,086 23,854,707 CopyNumber Variation_8784 (DGV)
15 20,852,150 23,222,284 CopyNumber Variation_8785 (DGV)
15 21,200,251 22,588,036 CopyNumber Variation_8786 (DGV)
15 20,167,089 22,588,036 CopyNumber Variation_9250 (DGV)
15 20,167,086 23,222,284 CopyNumber Variation_9251 (DGV), Variation_34504 (DGV)
15 20,879,638 22,777,875 CopyNumber Variation_9254 (DGV)
15 21,012,524 23,222,284 CopyNumber Variation_9256 (DGV)
15 21,097,124 22,449,059 CopyNumber Variation_9742 (DGV)
15 20,198,198 22,591,284 CopyNumber Variation_30670 (DGV)
15 20,171,787 22,646,418 CopyNumber Variation_31980 (DGV)
15 20,851,594 22,588,036 CopyNumber Variation_34545 (DGV)
15 20,167,086 22,862,959 CopyNumber Variation_34576 (DGV)
15 21,072,035 22,588,019 CopyNumber Variation_34607 (DGV)
15 20,167,089 23,222,284 CopyNumber Variation_34608 (DGV)
15 20,422,586 22,588,019 CopyNumber Variation_34663 (DGV)
15 20,167,089 22,869,763 CopyNumber Variation_34665 (DGV)
15 22,265,649 22,591,752 CopyNumber Variation_37535 (DGV), Variation_37626 (DGV)
15 20,161,372 22,351,239 CopyNumber Variation_49466 (DGV)
15 20,161,372 22,368,110 CopyNumber Variation_49467 (DGV)
15 20,161,372 22,449,059 CopyNumber Variation_49468 (DGV), Variation_49469 (DGV)
15 20,161,372 22,755,185 CopyNumber Variation_49470 (DGV)
15 20,161,372 23,226,254 CopyNumber Variation_49471 (DGV)
15 20,541,678 22,368,898 CopyNumber Variation_58702 (DGV)
15 22,287,131 22,399,235 CopyNumber Variation_59598 (DGV)
15 22,298,201 22,343,860 CopyNumber Variation_66725 (DGV)
15 22,294,228 22,311,474 CopyNumber Variation_72148 (DGV)
15 22,262,185 22,336,007 CopyNumber Variation_72150 (DGV)
15 22,262,185 22,596,129 CopyNumber Variation_72162 (DGV)
15 22,262,185 22,373,349 CopyNumber Variation_72167 (DGV)
15 22,262,145 22,453,425 CopyNumber Variation_76813 (DGV)
15 21,054,356 22,453,425 CopyNumber Variation_76814 (DGV), Variation_87462 (DGV)
15 21,362,809 22,453,425 CopyNumber Variation_76815 (DGV)
15 22,286,537 22,453,425 CopyNumber Variation_87461 (DGV)
15 21,276,422 22,453,425 CopyNumber Variation_87468 (DGV)
CopyNumber 23 (Hasin)
15 22,295,501 22,298,547 CopyNumber #161 (Waszak)
15 22,298,273 22,298,495 Del(-8) #24(modil)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.