Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11H5P Olfactory Receptor

Gene Symbol OR11H5P1 (View this gene in GeneCards)
Family 11
Subfamily H
Pseudogene Yes
CORP pseudogene probability score
Aliases OR14-31, HsOR14.1.26P, ORL3710
External Ids HGNC: 15348   GeneBank: BK004618, NG_004353   ORDB: ORL3710   
Build #39 labels OR11H5P
Chromosomal location 14:20,209,297-20,210,195 (+)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11H4 68.01% 297
OR11H6 68.35% 297
OR11H7P 66.22% 296

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11H6 68% 300
Mouse Or11h4 69% 297
Rat Or11h4 69% 297
Cow OR11H7 69% 297
Orang OR11H5 96% 286
Horse OR11H5 85% 300
Chimp OR11H5 97% 300

Sequence information

Nucleotide sequence ATGACGGAATTTGTTCTCCTTGGCTTTCCTGGTTGTCAGGAGATGCAAAGTTTCCTCTTC
TCCCTGTTCTTTGTGATCTATGTATTTACCATAATAGGAAATGGGACCATTGTCTGTGCT
GTGAGATTGGACAAACGGCTTCATACCCCAATGTATATTCTCCTAGGGAACTTTGCTTTC
CTTGAAATCCGGTAAGTTACTTCCACTGTACCCAACATGCTAGTCAACTTCCTCTCAGAG
ACAAAAACCATCTCTTTTGTTGGCTGTTTCCTCCAGTTCTACTTTTTTACTTCCCTTGGT
ACAATAGAAGCATACTTCCTCTGCATCATGGCATATGATCGGTACCTTGCTATCTGCCGC
CCATTGCACTACCCAACCATCATGACCCCACAACTCTGCTACATATTGATGTCTTTTTGC
TGGGTGTTTGGATTCCTCAGTTACTCTGTCTCCACTGTGCAACTGTCTCAACTGCCTTTC
TGTGGGCCCAACATCATCAATCACTTTTTGTGTGACATGGACCCACTGATGGCTCTGTCC
TGTGCCTCAGCTCCTATCACTGAGATTATCTTCTATATCCTGAGCTCCCTCATTATCATT
CTCACTCTTCTGTACATCTGTGGCTCCTATATGCTTTACTGATAGCTGTATTAAAAGTCC
CTTCAGCAGCTGGCCAGCAGAAGGCCTTTTCCACCTGTGGATCTCATCTGACAGTGGTGT
GTTTATTCTTTGGGGCCCTACTGGCAATGTATGTGAGCCCCACAACTGATAACCCAGCTG
CAATTTAGAAGATTATAACTTTGTTCTATTCTGTGGTGACCCCCTTCTTAAACCCCCTGA
TTTACAGCTTACGAAACAAAGAGATGAAGGCTGCGTTGAAGAAAGTCCTGAGGATAGAA
Conceptual translation MTEFVLLGFPGCQEMQSFLFSLFFVIYVFTIIGNGTIVCAVRLDKRLHTPMYILLGNFAF
LEIRXTSTVPNMLVNFLSETKTISFVGCFLQFYFFTSLGTIEAYFLCIMAYDRYLAICR
PLHYPTIMTPQLCYILMSFCWVFGFLSYSVSTVQLSQLPFCGPNIINHFLCDMDPLMALS
CASAPITEIIFYILSSLIIILTLLYICGSYM/LLIAVLKVPSAAGQQKAFSTCGSHLTV
VCLFFGALLAMYVSPTTDNPAAIXIITLFYSVVTPFLNPLIYSLRNKEMKAALKKVLRI
E

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 SNP C/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
14 20,209,387 20,209,387 SNP A/G 1000GP (CHBJPT)
14 20,209,432 20,209,432 SNP C/T 1000GP (CEU, CHBJPT)
14 20,209,564 20,209,564 SNP T/G 1000GP (CEU, CHBJPT)
14 20,209,655 20,209,655 SNP G/A 1000GP (CEU, CHBJPT)
14 20,209,843 20,209,843 SNP T/C 1000GP (CEU, CHBJPT)
14 20,677,591 20,677,591 SNP C/T rs9944095 (DbSNP)
14 20,677,621 20,677,620 Ins(1) -/A rs35095838 (DbSNP)
14 20,677,723 20,677,723 SNP G/T rs11628841 (DbSNP)
14 20,677,814 20,677,814 SNP A/G rs8012050 (DbSNP)
14 20,678,002 20,678,002 SNP C/T rs8004680 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 113 (Hasin)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.