Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11J1P Olfactory Receptor

Gene Symbol OR11J1P1 (View this gene in GeneCards)
Family 11
Subfamily J
Pseudogene Yes
CORP pseudogene probability score
Aliases OR15-10, OR15-12, HsOR15.1.3P, ORL3732
External Ids HGNC: 15369   GeneBank: AB065902, BK004627, BK004777, NG_004165   ORDB: ORL3732   
Build #39 labels OR11J1P
Chromosomal location 15:21,980,286-21,981,245 (-)
Cluster 15@22
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11J5P 99.38% 320

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11J6 85% 321
Mouse Or11j4 60% 309
Rat Or11j4 60% 309
Cow OR11J6 84% 321
Orang OR11J2P 68% 310
Horse OR11J6 86% 320
Chimp OR11J5P 93% 317

Expression evidences

Source Accession
ESTs BF328901

Sequence information

Nucleotide sequence ATGAGTGTCATAGAAGCCAATAACATTTCTGGGCCTGTGAGTGAATTTATCCTCCTGGGC
TTCCCCTGCCTGCTGCAGGGAGACCAAGATCCTCCTCTTTGTGGTCTTCTCCCTCATCTA
CCTTCTGACCCTCATGGGTAACACATCCATCATCTGCGCTGTGTGGTCAAGCCAGAAACT
CCACACACCTATGTACATCCTCTTGGCTAATTTCTCTTTCCTGGAGATCTGCTGCATTAG
TTCTGATGTCCCAAAATGTTGGCCAATCTCATCTCCCATATCAAGAGCATCTCCTATGCT
GGCTGCCTGCTCCAGTTCTTCTACTTCTCCATGTGTGCTGCAGAAGGCTACTTTCTGTCT
GTGATGTCCTTTGATCGGTTCCTTACCATCTGTCGACCTTTGCATTATCCCACAGTCATG
ACTCACCACCTGTGTGTCCGATTAGTGGCCTTCTGCAGGGCAGGTGGTTTTCTATCCATA
CTGATGCCTGCAGTGCTTATGTCCCGAGTGCCTTTCTGTGGCCCTAACATCACTGACCAT
TTTTTCTGTAACCTGGGACCATTGCTGGCACTGTCCTGTGCCCCAGTTCCCAAAACTACT
CTGACTTGTGCTACAGTAAGCTCTCTCATCATCTTCATCACCTTCCTCTACATTCTTGGG
TCCCATATCTTAGTTTTGCGAGCTGTTCTGTGGGTCCCAGCTGGCTCAGGCAGGAACAAA
GCTTTCTCTACATGTGCTTCCCATTTCTTGGTTGTTTCTTTCTTCTATGGCTCAGTCATG
GTGATGTATGTGAGTCCAGGCTCCAGGAGCCGCCCTGGGACACAGAAATTTGTGACATTG
TTTTACTGCACAGCAACCCCATTCTTTAATCCCCTGACCTACAGTCTCTGGAACAAAGAT
ATGACAGATGCCCTTAAAAAAGTGCTGGGAGTGCCATCAAAAGAAATATCTTGGAACACA
Conceptual translation MSVIEANNISGPVSEFILLGFP\CCRETKILLFVVFSLIYLLTLMGNTSIICAVWSSQK
LHTPMYILLANFSFLEICCIS/XPKMLANLISHIKSISYAGCLLQFFYFSMCAAEGYF
LSVMSFDRFLTICRPLHYPTVMTHHLCVRLVAFCRAGGFLSILMPAVLMSRVPFCGPNIT
DHFFCNLGPLLALSCAPVPKTTLTCATVSSLIIFITFLYILGSHILVLRAVLWVPAGSGR
NKAFSTCASHFLVVSFFYGSVMVMYVSPGSRSRPGTQKFVTLFYCTATPFFNPLTYSLWN
KDMTDALKKVLGVPSKEISWNT

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
15 21,980,806 21,980,806 SNP C/A 1000GP (CEU)

Variations - CNVs

Chr Start End Type Sources
15 20,266,957 22,674,466 CopyNumber Variation_0318 (DGV)
15 20,610,110 22,575,858 Inversion Variation_0443 (DGV)
15 20,625,544 22,559,977 Inversion Variation_0444 (DGV)
15 20,143,651 23,690,892 CopyNumber Variation_3070 (DGV)
15 20,003,725 23,814,757 CopyNumber Variation_3951 (DGV)
15 20,397,403 22,698,551 CopyNumber Variation_7046 (DGV)
15 20,167,086 22,588,036 CopyNumber Variation_8779 (DGV)
15 20,167,086 22,869,764 CopyNumber Variation_8781 (DGV)
15 20,935,075 22,777,875 CopyNumber Variation_8783 (DGV)
15 20,167,086 23,854,707 CopyNumber Variation_8784 (DGV)
15 20,852,150 23,222,284 CopyNumber Variation_8785 (DGV)
15 21,200,251 22,588,036 CopyNumber Variation_8786 (DGV)
15 20,167,089 22,588,036 CopyNumber Variation_9250 (DGV)
15 20,167,086 23,222,284 CopyNumber Variation_9251 (DGV), Variation_34504 (DGV)
15 20,879,638 22,777,875 CopyNumber Variation_9254 (DGV)
15 21,012,524 23,222,284 CopyNumber Variation_9256 (DGV)
15 21,097,124 22,449,059 CopyNumber Variation_9742 (DGV)
15 20,198,198 22,591,284 CopyNumber Variation_30670 (DGV)
15 20,171,787 22,646,418 CopyNumber Variation_31980 (DGV)
15 20,851,594 22,588,036 CopyNumber Variation_34545 (DGV)
15 20,167,086 22,862,959 CopyNumber Variation_34576 (DGV)
15 21,072,035 22,588,019 CopyNumber Variation_34607 (DGV)
15 20,167,089 23,222,284 CopyNumber Variation_34608 (DGV)
15 20,422,586 22,588,019 CopyNumber Variation_34663 (DGV)
15 20,167,089 22,869,763 CopyNumber Variation_34665 (DGV)
15 22,265,649 22,591,752 CopyNumber Variation_37535 (DGV), Variation_37626 (DGV)
15 20,161,372 22,351,239 CopyNumber Variation_49466 (DGV)
15 20,161,372 22,368,110 CopyNumber Variation_49467 (DGV)
15 20,161,372 22,449,059 CopyNumber Variation_49468 (DGV), Variation_49469 (DGV)
15 20,161,372 22,755,185 CopyNumber Variation_49470 (DGV)
15 20,161,372 23,226,254 CopyNumber Variation_49471 (DGV)
15 20,541,678 22,368,898 CopyNumber Variation_58702 (DGV)
15 22,262,185 22,336,007 CopyNumber Variation_72150 (DGV)
15 22,262,185 22,596,129 CopyNumber Variation_72162 (DGV)
15 22,262,185 22,296,984 CopyNumber Variation_72163 (DGV)
15 22,262,185 22,373,349 CopyNumber Variation_72167 (DGV)
15 22,262,145 22,453,425 CopyNumber Variation_76813 (DGV)
15 21,054,356 22,453,425 CopyNumber Variation_76814 (DGV), Variation_87462 (DGV)
15 21,362,809 22,453,425 CopyNumber Variation_76815 (DGV)
15 21,276,422 22,453,425 CopyNumber Variation_87468 (DGV)
CopyNumber 119 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR11J1P.aApr07-unspliced main_exon CDS_partial chr15 21,980,573 21,980,943 -