Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11J2P Olfactory Receptor

Gene Symbol OR11J2P1 (View this gene in GeneCards)
Family 11
Subfamily J
Pseudogene Yes
CORP pseudogene probability score
Aliases OR15-11, HsOR15.1.1P, ORL3733
External Ids HGNC: 15370   GeneBank: AK027771, BK004778, NG_004164   ORDB: ORL3733   
Build #39 labels OR11J2P
Chromosomal location 15:20,960,661-20,961,606 (+)
Cluster 15@21
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11J1P 70.92% 306
OR11J5P 70.92% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11J6 74% 304
Mouse Or11j4 63% 302
Rat Or11j4 63% 302
Cow OR11J12 79% 309
Orang OR11G2 60% 293
Horse OR11J2 81% 310
Chimp OR11J5P 73% 305

Expression evidences

Source Accession
mRNA AK027771

Sequence information

Nucleotide sequence GTGAGGACCTTGGAGACTACTAATATCACTGGATTTGTGAATGAGTTCATCCTCTTGGGC
TTCCCCTGCCGCTGGGAGATCCAGATCCTCCTTTTTGTGGTCTTCTCTCTCATCTACCTT
CTGACCCTCCTAGGTAACACATCCATCATCTGTGCTGTGTGGTCAAGCCAGAAACTCCAC
ACACCTATGTACATCCTACTGGCCAATTTCTCCTTCCTGGAGATCTGCTGTGTCAGTTCT
GACGTGCCCATAATGGCAGCCAATCTCATCTCCCAGACACAGAGCATCTCCTGTGCTGGC
TGCCTGCTCCGGTTCTACTTCTTCTCCATGTGTGCTGCAGAGTGCTTATTTCTGTCAGTG
ATGTCTTTTGATAGGTTTCCTGCCATTTGTAGACCTTTGCACTATCCCACCTTAATGACC
CATCACGTTTGTGCTCATTTTTGTGATCTTCTGCTGGGTGGGTGGCTGTCTCTGGTTATT
GACCCCTTTGACACTAATATCTCAGGTGCTCTTTTGTGGTCCAAACACTATCGACCATTT
TTTCTGTGATCTGGCACCTTTGCTGGCACTGTCTTGTGCTCCAATACCTGGAATTACTCT
GACTTGTGGTATCATTAGCGCTCTCATCATCTTTCTTACCTTCTTGTATATCCTTGGGAC
TTATTTCTGTGTTCTAAGCACAGTGCTACAGGTGCCTTCAGGCTTAGGAAGGCATAAGGC
TTTCTCAACTTGTGGCTGTCACCTTGCTGTAGTGTCTCTCTTCTATGGTTCTCTTATGGT
GATGTATGTTAGCCCAGGTTCTGGGGACTATCATGGGATAAAGAAATTTGCGACCTTGTT
CTATACTTTGTCAACTCCATTCTTTAATCCTCTGATCTACAGTTTCCGGAACAAGGATAT
GAAAGAGGCACTAAAGAAATTTCTGAGGAATCGCCACACTGTCGAT
Conceptual translation VRTLETTNITGFVNEFILLGFPCRWEIQILLFVVFSLIYLLTLLGNTSIICAVWSSQKLH
TPMYILLANFSFLEICCVSSDVPIMAANLISQTQSISCAGCLLRFYFFSMCAAECLFLSV
MSFDRFPAICRPLHYPTLMTHHVC\IFVIFCWVGGCLWLLTPLTLISQVLFCGPNTIDH
FFCDLAPLLALSCAPIPGITLTCGIISALIIFLTFLYILGTYFCVLSTVLQVPSGLGRHK
AFSTCGCHLAVVSLFYGSLMVMYVSPGSGDYHGIKKFATLFYTLSTPFFNPLIYSFRNKD
MKEALKKFLRNRHTVD

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
15 21,166,431 21,166,431 Del(1) -/T rs67188104 (DbSNP)
15 21,166,427 21,166,427 Del(1) -/T rs66673716 (DbSNP)
15 21,166,613 21,166,614 Del(2) -/TC rs68007443 (DbSNP)
15 21,166,533 21,166,532 Ins(1) -/A rs71226095 (DbSNP)
15 21,166,552 21,166,552 SNP A/C rs74006143 (DbSNP)
15 21,166,859 21,166,859 SNP A/C rs12593385 (DbSNP)
15 21,166,886 21,166,886 SNP A/G rs12437447 (DbSNP)
15 21,166,301 21,166,301 SNP A/G rs10902984 (DbSNP)
15 21,166,765 21,166,765 SNP A/G rs11248686 (DbSNP)
15 21,166,128 21,166,128 SNP A/G rs8039885 (DbSNP)
15 21,166,121 21,166,121 SNP A/G rs3852649 (DbSNP)
15 21,166,062 21,166,062 SNP A/T rs3852650 (DbSNP)
15 21,166,309 21,166,309 SNP A/T rs60384284 (DbSNP)
15 21,166,497 21,166,497 SNP C/G rs2664964 (DbSNP)
15 21,166,820 21,166,820 SNP C/T rs2626170 (DbSNP)
15 21,166,369 21,166,369 SNP C/T rs8039649 (DbSNP)
15 21,166,619 21,166,619 SNP C/T rs8024691 (DbSNP)
15 21,166,608 21,166,608 SNP C/T rs3852648 (DbSNP)
15 21,166,028 21,166,028 SNP G/A rs2664965 (DbSNP)
15 21,166,015 21,166,015 SNP T/C rs2664966 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
15 20,266,957 22,674,466 CopyNumber Variation_0318 (DGV)
15 20,610,110 22,575,858 Inversion Variation_0443 (DGV)
15 20,625,544 22,559,977 Inversion Variation_0444 (DGV)
15 20,143,651 23,690,892 CopyNumber Variation_3070 (DGV)
15 20,003,725 23,814,757 CopyNumber Variation_3951 (DGV)
15 21,040,509 21,203,278 CopyNumber Variation_4871 (DGV)
15 20,397,403 22,698,551 CopyNumber Variation_7046 (DGV)
15 20,167,086 22,588,036 CopyNumber Variation_8779 (DGV)
15 20,167,086 21,200,251 CopyNumber Variation_8780 (DGV), Variation_34562 (DGV)
15 20,167,086 22,869,764 CopyNumber Variation_8781 (DGV)
15 20,935,075 22,777,875 CopyNumber Variation_8783 (DGV)
15 20,167,086 23,854,707 CopyNumber Variation_8784 (DGV)
15 20,852,150 23,222,284 CopyNumber Variation_8785 (DGV)
15 20,167,089 22,588,036 CopyNumber Variation_9250 (DGV)
15 20,167,086 23,222,284 CopyNumber Variation_9251 (DGV), Variation_34504 (DGV)
15 20,167,089 21,200,251 CopyNumber Variation_9253 (DGV)
15 20,879,638 22,777,875 CopyNumber Variation_9254 (DGV)
15 20,586,927 21,200,251 CopyNumber Variation_9255 (DGV)
15 21,012,524 23,222,284 CopyNumber Variation_9256 (DGV)
15 21,097,124 22,449,059 CopyNumber Variation_9742 (DGV)
15 20,198,198 22,591,284 CopyNumber Variation_30670 (DGV)
15 20,171,787 22,646,418 CopyNumber Variation_31980 (DGV)
15 20,851,594 22,588,036 CopyNumber Variation_34545 (DGV)
15 20,167,086 22,862,959 CopyNumber Variation_34576 (DGV)
15 21,072,035 22,588,019 CopyNumber Variation_34607 (DGV)
15 20,167,089 23,222,284 CopyNumber Variation_34608 (DGV)
15 20,422,586 22,588,019 CopyNumber Variation_34663 (DGV)
15 20,167,089 22,869,763 CopyNumber Variation_34665 (DGV)
15 20,550,037 21,200,759 CopyNumber Variation_38976 (DGV)
15 20,161,372 22,351,239 CopyNumber Variation_49466 (DGV)
15 20,161,372 22,368,110 CopyNumber Variation_49467 (DGV)
15 20,161,372 22,449,059 CopyNumber Variation_49468 (DGV), Variation_49469 (DGV)
15 20,161,372 22,755,185 CopyNumber Variation_49470 (DGV)
15 20,161,372 23,226,254 CopyNumber Variation_49471 (DGV)
15 20,541,678 22,368,898 CopyNumber Variation_58702 (DGV)
15 20,835,037 21,191,658 CopyNumber Variation_59597 (DGV)
15 21,163,006 21,166,495 CopyNumber Variation_63050 (DGV)
15 21,146,888 21,241,912 CopyNumber Variation_72121 (DGV)
15 21,074,457 21,283,596 CopyNumber Variation_72130 (DGV)
15 20,784,852 21,398,778 CopyNumber Variation_72142 (DGV)
15 21,054,356 22,453,425 CopyNumber Variation_76814 (DGV), Variation_87462 (DGV)
15 21,054,356 21,301,403 CopyNumber Variation_76818 (DGV)
15 21,054,356 21,177,694 CopyNumber Variation_87465 (DGV)
15 21,054,356 21,288,901 CopyNumber Variation_87466 (DGV)
15 21,077,038 21,168,392 CopyNumber Variation_102041 (DGV)
CopyNumber 236 (Hasin)
15 21,165,890 21,168,935 CopyNumber #174 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.