Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11J5P Olfactory Receptor

Gene Symbol OR11J5P1 (View this gene in GeneCards)
Family 11
Subfamily J
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR15.1.2P
External Ids HGNC: 31238   GeneBank: NG_004403   
Build #39 labels
Chromosomal location 15:20,969,250-20,970,209 (-)
Cluster 15@21
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11J1P 99.38% 320

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11J6 84% 321
Chimp OR11J2P 72% 303
Mouse Or11j4 60% 309
Rat Or11j4 60% 309
Cow OR11J6 83% 321
Orang OR11J2P 68% 310
Horse OR11J6 86% 320

Expression evidences

Source Accession
ESTs BF328901

Sequence information

Nucleotide sequence ATGAGTGTCGTAGAAGCCAATAACATTTCTGGGCCTGTGAGTGAATTTATCCTCCTGGGC
TTCCCCTGCCTGCTGCAGGGAGACCAAGATCCTCCTCTTTGTGGTCTTCTCCCTCATCTA
CCTTCTGACCCTCATGGGTAACACATCCATCATCTGCGCTGTGTGGTCAAGCCAGAAACT
CCACACACCTATGTACATCCTCTTGGCTAATTTCTCTTTCCTGGAGATCTGCTGCATTAG
TTCTGATGTCCCAAAATGTTGGCCAATCTCATCTCCCATATCAAGAGCATCTCCTATGCT
GGCTGCCTGCTCCAGTTCTTCTACTTCTCCATGTGTGCTGCAGAAGGCTACTTTCTGTCT
GTGATGTCCTTTGATCGGTTCCTTACCATCTGTCGACCTTTGCATTATCCCACAGTCATG
ACTCACCACCTGTGTGTCTGATTAGTGGCCTTCTGCAGGGCAGGTGGTTTTCTATCCATA
CTGATGCCTGCAGTGCTTATGTCCCGAGTGCCTTTCTGTGGCCCTAACATCACTGACCAT
TTTTTCTGTAACCTGGGACCATTGCTGGCACTGTCCTGTGCCCCAGTTCCCAAAACTACT
CTGACTTGTGCTACAGTAAGCTCTCTCATCATCTTCATCACCTTCCTCTACATTCTTGGG
TCCCATATCTTAGTTTTGCGAGCTGTTCTGTGGGTCCCAGCTGGCTCAGGCAGGAACAAA
GCTTTCTCTACATGTGCTTCCCATTTCTTGGTTGTTTCTTTCTTCTATGGCTCAGTCATG
GTGATGTATGTGAGTCCAGGCTCCAGGAGCCGCCCTGGGACACAGAAATTTGTGACATTG
TTTTACTGCACAGCAACCCCATTCTTTAATCCCCTGACCTACAGTCTCTGGAACAAAGAT
ATGACAGATGCCCTTAAAAAAGTGCTGGGAGTGCCATCAAAAGAAATATCTTGGAACACA
Conceptual translation MSVVEANNISGPVSEFILLGFP\CCRETKILLFVVFSLIYLLTLMGNTSIICAVWSSQK
LHTPMYILLANFSFLEICCIS/XPKMLANLISHIKSISYAGCLLQFFYFSMCAAEGYF
LSVMSFDRFLTICRPLHYPTVMTHHLCVXVAFCRAGGFLSILMPAVLMSRVPFCGPNIT
DHFFCNLGPLLALSCAPVPKTTLTCATVSSLIIFITFLYILGSHILVLRAVLWVPAGSGR
NKAFSTCASHFLVVSFFYGSVMVMYVSPGSRSRPGTQKFVTLFYCTATPFFNPLTYSLWN
KDMTDALKKVLGVPSKEISWNT

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
15 20,003,725 23,814,757 CopyNumber Variation_3951 (DGV)
15 20,143,651 23,690,892 CopyNumber Variation_3070 (DGV)
15 20,161,372 22,351,239 CopyNumber Variation_49466 (DGV)
15 20,161,372 22,368,110 CopyNumber Variation_49467 (DGV)
15 20,161,372 22,449,059 CopyNumber Variation_49468 (DGV), Variation_49469 (DGV)
15 20,161,372 22,755,185 CopyNumber Variation_49470 (DGV)
15 20,161,372 23,226,254 CopyNumber Variation_49471 (DGV)
15 20,167,086 21,200,251 CopyNumber Variation_8780 (DGV), Variation_34562 (DGV)
15 20,167,086 22,588,036 CopyNumber Variation_8779 (DGV)
15 20,167,086 22,862,959 CopyNumber Variation_34576 (DGV)
15 20,167,086 22,869,764 CopyNumber Variation_8781 (DGV)
15 20,167,086 23,222,284 CopyNumber Variation_9251 (DGV), Variation_34504 (DGV)
15 20,167,086 23,854,707 CopyNumber Variation_8784 (DGV)
15 20,167,089 21,200,251 CopyNumber Variation_9253 (DGV)
15 20,167,089 22,588,036 CopyNumber Variation_9250 (DGV)
15 20,167,089 22,869,763 CopyNumber Variation_34665 (DGV)
15 20,167,089 23,222,284 CopyNumber Variation_34608 (DGV)
15 20,171,787 22,646,418 CopyNumber Variation_31980 (DGV)
15 20,198,198 22,591,284 CopyNumber Variation_30670 (DGV)
15 20,266,957 22,674,466 CopyNumber Variation_0318 (DGV)
15 20,397,403 22,698,551 CopyNumber Variation_7046 (DGV)
15 20,422,586 22,588,019 CopyNumber Variation_34663 (DGV)
15 20,541,678 22,368,898 CopyNumber Variation_58702 (DGV)
15 20,550,037 21,200,759 CopyNumber Variation_38976 (DGV)
15 20,586,927 21,200,251 CopyNumber Variation_9255 (DGV)
15 20,610,110 22,575,858 Inversion Variation_0443 (DGV)
15 20,625,544 22,559,977 Inversion Variation_0444 (DGV)
15 20,784,852 21,398,778 CopyNumber Variation_72142 (DGV)
15 20,835,037 21,191,658 CopyNumber Variation_59597 (DGV)
15 20,851,594 22,588,036 CopyNumber Variation_34545 (DGV)
15 20,852,150 23,222,284 CopyNumber Variation_8785 (DGV)
15 20,879,638 22,777,875 CopyNumber Variation_9254 (DGV)
15 20,935,075 22,777,875 CopyNumber Variation_8783 (DGV)
15 21,012,524 23,222,284 CopyNumber Variation_9256 (DGV)
15 21,040,509 21,203,278 CopyNumber Variation_4871 (DGV)
15 21,054,356 21,177,694 CopyNumber Variation_87465 (DGV)
15 21,054,356 21,288,901 CopyNumber Variation_87466 (DGV)
15 21,054,356 21,301,403 CopyNumber Variation_76818 (DGV)
15 21,054,356 22,453,425 CopyNumber Variation_76814 (DGV), Variation_87462 (DGV)
15 21,072,035 22,588,019 CopyNumber Variation_34607 (DGV)
15 21,074,457 21,283,596 CopyNumber Variation_72130 (DGV)
15 21,097,124 22,449,059 CopyNumber Variation_9742 (DGV)
15 21,146,888 21,241,912 CopyNumber Variation_72121 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR11J5P.aApr07-unspliced main_exon CDS_partial chr15 20,969,537 20,969,907 -