Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11J6P Olfactory Receptor

Gene Symbol OR11J6P1 (View this gene in GeneCards)
Family 11
Subfamily J
Pseudogene Yes
CORP pseudogene probability score
Aliases OR11-36, HsOR11.3.54
External Ids HGNC: 38588   
Build #39 labels OR51V1, OR51A12
Chromosomal location 15:21,542,999-21,543,958 (-)
Cluster 15@22
Synteny CLIC#0
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11J6 85% 321
Mouse Or11j4 60% 309
Rat Or11j4 60% 309
Cow OR11J6 84% 321
Orang OR11J2P 68% 310
Horse OR11J6 86% 320
Chimp OR11J5P 93% 317

Expression evidences

Source Accession
ESTs BF328901
GNF Atlas2 gnf1h10910_at

Sequence information

Nucleotide sequence ATGAGTGTCATAGAAGCCAATAACATTTCTGGGCCTGTGAGTGAATTTATCCTCCTGGGC
TTCCCCTGCCTGCTGCAGGGAGACCAAGATCCTCCTCTTTGTGGTCTTCTCCCTCATCTA
CCTTCTGACCCTCATGGGTAACACATCCATCATCTGCGCTGTGTGGTCAAGCCAGAAACT
CCACACACCTATGTACATCCTCTTGGCTAATTTCTCTTTCCTGGAGATCTGCTGCATTAG
TTCTGATGTCCCAAAATGTTGGCCAATCTCATCTCCCATATCAAGAGCATCTCCTATGCT
GGCTGCCTGCTCCAGTTCTTCTACTTCTCCATGTGTGCTGCAGAAGGCTACTTTCTGTCT
GTGATGTCCTTTGATCGGTTCCTTACCATCTGTCGACCTTTGCATTATCCCACAGTCATG
ACTCACCACCTGTGTGTCCGATTAGTGGCCTTCTGCAGGGCAGGTGGTTTTCTATCCATA
CTGATGCCTGCAGTGCTTATGTCCCGAGTGCCTTTCTGTGGCCCTAACATCACTGACCAT
TTTTTCTGTAACCTGGGACCATTGCTGGCACTGTCCTGTGCCCCAGTTCCCAAAACTACT
CTGACTTGTGCTACAGTAAGCTCTCTCATCATCTTCATCACCTTCCTCTACATTCTTGGG
TCCCATATCTTAGTTTTGCGAGCTGTTCTGTGGGTCCCAGCTGGCTCAGGCAGGAACAAA
GCTTTCTCTACATGTGCTTCCCATTTCTTGGTTGTTTCTTTCTTCTATGGCTCAGTCATG
GTGATGTATGTGAGTCCAGGCTCCAGGAGCCGCCCTGGGACACAGAAATTTGTGACATTG
TTTTACTGCACAGCAACCCCATTCTTTAATCCCCTGACCTACAGTCTCTGGAACAAAGAT
ATGACAGATGCCCTTAAAAAAGTGCTGGGAGTGCCATCAAAAGAAATATCTTGGAACACA
Conceptual translation MSVIEANNISGPVSEFILLGFP\CCRETKILLFVVFSLIYLLTLMGNTSIICAVWSSQK
LHTPMYILLANFSFLEICCIS/XPKMLANLISHIKSISYAGCLLQFFYFSMCAAEGYF
LSVMSFDRFLTICRPLHYPTVMTHHLCVRLVAFCRAGGFLSILMPAVLMSRVPFCGPNIT
DHFFCNLGPLLALSCAPVPKTTLTCATVSSLIIFITFLYILGSHILVLRAVLWVPAGSGR
NKAFSTCASHFLVVSFFYGSVMVMYVSPGSRSRPGTQKFVTLFYCTATPFFNPLTYSLWN
KDMTDALKKVLGVPSKEISWNT

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
15 20,266,957 22,674,466 CopyNumber Variation_0318 (DGV)
15 20,610,110 22,575,858 Inversion Variation_0443 (DGV)
15 20,625,544 22,559,977 Inversion Variation_0444 (DGV)
15 20,143,651 23,690,892 CopyNumber Variation_3070 (DGV)
15 20,003,725 23,814,757 CopyNumber Variation_3951 (DGV)
15 20,397,403 22,698,551 CopyNumber Variation_7046 (DGV)
15 20,167,086 22,588,036 CopyNumber Variation_8779 (DGV)
15 20,167,086 22,869,764 CopyNumber Variation_8781 (DGV)
15 20,935,075 22,777,875 CopyNumber Variation_8783 (DGV)
15 20,167,086 23,854,707 CopyNumber Variation_8784 (DGV)
15 20,852,150 23,222,284 CopyNumber Variation_8785 (DGV)
15 21,200,251 22,588,036 CopyNumber Variation_8786 (DGV)
15 20,167,089 22,588,036 CopyNumber Variation_9250 (DGV)
15 20,167,086 23,222,284 CopyNumber Variation_9251 (DGV), Variation_34504 (DGV)
15 20,879,638 22,777,875 CopyNumber Variation_9254 (DGV)
15 21,012,524 23,222,284 CopyNumber Variation_9256 (DGV)
15 21,097,124 22,449,059 CopyNumber Variation_9742 (DGV)
15 20,198,198 22,591,284 CopyNumber Variation_30670 (DGV)
15 20,171,787 22,646,418 CopyNumber Variation_31980 (DGV)
15 20,851,594 22,588,036 CopyNumber Variation_34545 (DGV)
15 20,167,086 22,862,959 CopyNumber Variation_34576 (DGV)
15 21,072,035 22,588,019 CopyNumber Variation_34607 (DGV)
15 20,167,089 23,222,284 CopyNumber Variation_34608 (DGV)
15 20,422,586 22,588,019 CopyNumber Variation_34663 (DGV)
15 20,167,089 22,869,763 CopyNumber Variation_34665 (DGV)
15 20,161,372 22,351,239 CopyNumber Variation_49466 (DGV)
15 20,161,372 22,368,110 CopyNumber Variation_49467 (DGV)
15 20,161,372 22,449,059 CopyNumber Variation_49468 (DGV), Variation_49469 (DGV)
15 20,161,372 22,755,185 CopyNumber Variation_49470 (DGV)
15 20,161,372 23,226,254 CopyNumber Variation_49471 (DGV)
15 20,541,678 22,368,898 CopyNumber Variation_58702 (DGV)
15 21,054,356 22,453,425 CopyNumber Variation_76814 (DGV), Variation_87462 (DGV)
15 21,362,809 22,453,425 CopyNumber Variation_76815 (DGV)
15 21,276,422 22,453,425 CopyNumber Variation_87468 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.