Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11K1P Olfactory Receptor

Gene Symbol OR11K1P1 (View this gene in GeneCards)
Family 11
Subfamily K
Pseudogene Yes
CORP pseudogene probability score
Aliases OR15-7, HsOR15.1.5P, ORL3727
External Ids HGNC: 15371   GeneBank: AB065906, BK004799, NG_004163   ORDB: ORL3727   
Build #39 labels OR11K1P
Chromosomal location 15:22,030,903-22,031,831 (-)
Cluster 15@22
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11K2P 90.1% 313

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11K2 79% 312
Mouse Or11g2 57% 303
Rat Or11j4 57% 298
Cow OR11K2 73% 311
Orang OR11K2 88% 313
Orang OR11K2B 86% 313
Orang OR11K2C 86% 313
Horse OR11K6 78% 312
Chimp OR11G2 58% 296

Expression evidences

Source Accession
ESTs DB450174
mRNA AB529228

Sequence information

Nucleotide sequence ATGGAAACTATCAATTTTGTTAGCTGCCTTATCCTCATGGGCTTTCCCTCAAGCCCAGAA
ATGCAGCTCCTCTACTTCGGTCTCTTCTCAGTAGCCTATACTCTCACCCCGATGGGAAAT
GCAGCCATTGTCTGTGCTGTGTGGTAGGACCAGCACCTTCACACTCCCATGTACACCCTC
TTGGGAAATTTCTCTCTCCTGGAAATATGTTATGTTACTGCAACTAAACTGCTGGCCAAC
TTCCTCTCCACAAGCAAGTCCATCTCATTCATGAGTTGTTTTGCACAGTTCTACTTCTTC
TCTTTGGGGTATGATGAGGGCTTCTTCCTTTGCATCACGGCCTTTGACAGGTATCTTGCC
ATCTGCCGCCCTCTACGTTATCCATGCATCATGACTAAACAAGTATGCACTGGCCTCATC
ATTTTTGCATGGTCATGTGTCTTTGTAATCTTCCTAACTCTGGTGATTCTCATTTCACAG
CTATCCTACTGTGGCCCAAATATTATCAACCATTTTATTTGTGATCCCGTCCCATTGAAG
ATGCTGTCCTGTTCTGAAGACATCATCATCACCCAGCTCATTTACTCCACATTCAATTCT
GTCTTCATAATTGGCACCTTTCTCTTTATCCTTTGTTCCTATGCTCTGGTGATTCTGGCT
ATAATACGGATGCCTTCAGAGGCTGGCAAACGAAAAGCTTTCTCCACTTGTGCCTCTCAT
TTGGCAGTTGTCACCTTATTTTATGGCTCTATCATGGTGATGTATGTTAGTCCTGGATCA
GCACACCCAGTAAAAATGAAAAAATCATTACCTTGTTCTTTTCTGTGATAACACCACTCT
GTAATCCTCTAATATATAGTCTCAGGAACAAAGAGATGAAAGATTATCTGAGGAAAATCT
TCAGGACTGGAAAAGATGTTAATAAAATA
Conceptual translation METINFVSCLILMGFPSSPEMQLLYFGLFSVAYTLTPMGNAAIVCAVWXQHLHTPMYTL
LGNFSLLEICYVTATKLLANFLSTSKSISFMSCFAQFYFFSLGYDEGFFLCITAFDRYLA
ICRPLRYPCIMTKQVCTGLIIFAWSCVFVIFLTLVILISQLSYCGPNIINHFICDPVPLK
MLSCSEDIIITQLIYSTFNSVFIIGTFLFILCSYALVILAIIRMPSEAGKRKAFSTCASH
LAVVTLFYGSIMVMYVSPGSAH/SKNEKIITLFFSVITPLCNPLIYSLRNKEMKDYLRK
IFRTGKDVNKI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
15 22,318,917 22,318,916 Ins(1) -/C rs35152413 (DbSNP)
15 22,319,428 22,319,428 SNP A/G rs58008868 (DbSNP)
15 22,319,253 22,319,253 SNP A/G rs6602967 (DbSNP)
15 22,319,445 22,319,445 SNP A/G rs6602968 (DbSNP)
15 22,319,781 22,319,781 SNP A/G rs17157687 (DbSNP)
15 22,319,410 22,319,410 SNP A/G rs8029027 (DbSNP)
15 22,319,079 22,319,079 SNP A/G rs28509257 (DbSNP)
15 22,319,565 22,319,565 SNP A/G rs4779265 (DbSNP)
15 22,319,389 22,319,389 SNP A/T rs8025521 (DbSNP)
15 22,318,963 22,318,963 SNP A/T rs1429506 (DbSNP)
15 22,319,455 22,319,455 SNP C/G rs58319275 (DbSNP)
15 22,319,497 22,319,497 SNP C/G rs1366875 (DbSNP)
15 22,319,581 22,319,581 SNP C/G rs28495940 (DbSNP)
15 22,319,148 22,319,148 SNP C/G rs71455753 (DbSNP)
15 22,319,295 22,319,295 SNP C/T rs4779264 (DbSNP)
15 22,319,174 22,319,174 SNP C/T rs6602966 (DbSNP)
15 22,319,483 22,319,483 SNP G/A rs995427 (DbSNP)
15 22,319,605 22,319,605 SNP G/T rs74002726 (DbSNP)
15 22,319,166 22,319,166 SNP T/G rs1429505 (DbSNP)
15 22,031,012 22,031,012 SNP A/T 1000GP (CEU, CHBJPT)
15 22,031,344 22,031,344 SNP T/C 1000GP (CEU, CHBJPT)
15 22,031,494 22,031,494 SNP G/A 1000GP (CEU, CHBJPT)
15 22,031,532 22,031,532 SNP G/A 1000GP (CEU, CHBJPT)
15 22,031,614 22,031,614 SNP G/A 1000GP (CEU, CHBJPT)
15 22,031,302 22,031,302 SNP A/G 1000GP (CHBJPT)
15 22,031,438 22,031,438 SNP T/A 1000GP (CHBJPT)
15 22,031,830 22,031,830 SNP A/G 1000GP (CHBJPT)
15 100 -100 SNP A/T 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
15 20,266,957 22,674,466 CopyNumber Variation_0318 (DGV)
15 20,610,110 22,575,858 Inversion Variation_0443 (DGV)
15 20,625,544 22,559,977 Inversion Variation_0444 (DGV)
15 22,307,069 22,474,088 CopyNumber Variation_2182 (DGV)
15 20,143,651 23,690,892 CopyNumber Variation_3070 (DGV)
15 20,003,725 23,814,757 CopyNumber Variation_3951 (DGV)
15 20,397,403 22,698,551 CopyNumber Variation_7046 (DGV)
15 20,167,086 22,588,036 CopyNumber Variation_8779 (DGV)
15 20,167,086 22,869,764 CopyNumber Variation_8781 (DGV)
15 20,935,075 22,777,875 CopyNumber Variation_8783 (DGV)
15 20,167,086 23,854,707 CopyNumber Variation_8784 (DGV)
15 20,852,150 23,222,284 CopyNumber Variation_8785 (DGV)
15 21,200,251 22,588,036 CopyNumber Variation_8786 (DGV)
15 20,167,089 22,588,036 CopyNumber Variation_9250 (DGV)
15 20,167,086 23,222,284 CopyNumber Variation_9251 (DGV), Variation_34504 (DGV)
15 20,879,638 22,777,875 CopyNumber Variation_9254 (DGV)
15 21,012,524 23,222,284 CopyNumber Variation_9256 (DGV)
15 21,097,124 22,449,059 CopyNumber Variation_9742 (DGV)
15 20,198,198 22,591,284 CopyNumber Variation_30670 (DGV)
15 20,171,787 22,646,418 CopyNumber Variation_31980 (DGV)
15 20,851,594 22,588,036 CopyNumber Variation_34545 (DGV)
15 20,167,086 22,862,959 CopyNumber Variation_34576 (DGV)
15 21,072,035 22,588,019 CopyNumber Variation_34607 (DGV)
15 20,167,089 23,222,284 CopyNumber Variation_34608 (DGV)
15 20,422,586 22,588,019 CopyNumber Variation_34663 (DGV)
15 20,167,089 22,869,763 CopyNumber Variation_34665 (DGV)
15 22,265,649 22,591,752 CopyNumber Variation_37535 (DGV), Variation_37626 (DGV)
15 22,302,006 22,588,022 CopyNumber Variation_38952 (DGV)
15 20,161,372 22,351,239 CopyNumber Variation_49466 (DGV)
15 20,161,372 22,368,110 CopyNumber Variation_49467 (DGV)
15 20,161,372 22,449,059 CopyNumber Variation_49468 (DGV), Variation_49469 (DGV)
15 20,161,372 22,755,185 CopyNumber Variation_49470 (DGV)
15 20,161,372 23,226,254 CopyNumber Variation_49471 (DGV)
15 20,541,678 22,368,898 CopyNumber Variation_58702 (DGV)
15 22,287,131 22,399,235 CopyNumber Variation_59598 (DGV)
15 22,298,201 22,343,860 CopyNumber Variation_66725 (DGV)
15 22,262,185 22,336,007 CopyNumber Variation_72150 (DGV)
15 22,304,940 22,427,590 CopyNumber Variation_72152 (DGV)
15 22,262,185 22,596,129 CopyNumber Variation_72162 (DGV)
15 22,262,185 22,373,349 CopyNumber Variation_72167 (DGV)
15 22,262,145 22,453,425 CopyNumber Variation_76813 (DGV)
15 21,054,356 22,453,425 CopyNumber Variation_76814 (DGV), Variation_87462 (DGV)
15 21,362,809 22,453,425 CopyNumber Variation_76815 (DGV)
15 22,286,537 22,453,425 CopyNumber Variation_87461 (DGV)
15 21,276,422 22,453,425 CopyNumber Variation_87468 (DGV)
15 22,316,854 22,319,882 Deletion, CopyNumber #262 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR11K1P.aApr07-unspliced main_exon 3UTR chr15 22,030,583 22,030,903 -
CDS_partial chr15 22,030,903 22,030,967 -