Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11L1 Olfactory Receptor

Gene Symbol OR11L11 (View this gene in GeneCards)
Family 11
Subfamily L
Pseudogene No
CORP pseudogene probability score 0.21 (functional)
Aliases OR1-50, HsOR1.5.14, ORL3009
External Ids HGNC: 14998   GeneBank: AB065646, BK004461, NM_001001959   ORDB: ORL3009   
Build #39 labels OR11L1
Chromosomal location 1:247,840,931-247,841,896 (-)
Cluster 1@248
Synteny CLIC#5
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR10C1 50.99% 304
OR11G2 51.16% 301
OR6B1 50.66% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11L2 78% 320
Mouse Or11l3 79% 311
Rat Or11l3 76% 317
Cow OR11G2B 52% 303
Orang OR6B1 51% 304
Horse OR11L4P 79% 311
Horse OR11L1P 80% 251
Chimp OR11G2 52% 302

Expression evidences

Source Accession
mRNA AB529291
GNF Atlas2 gnf1h10833_at

Sequence information

Nucleotide sequence ATGGAGCCCCAAAATACCTCCACTGTGACTAACTTTCAGCTGTTAGGATTCCAGAACCTT
CTTGAATGGCAGGCCCTGCTCTTTGTCATTTTCCTGCTCATCTACTGCCTGACCATTATA
GGGAATGTTGTCATCATCACCGTGGTGAGCCAGGGCCTGCGACTGCACTCCCCTATGTAC
ATGTTCCTCCAGCATCTCTCCTTTCTGGAGGTCTGGTACACGTCCACCACTGTGCCCCTT
CTCCTAGCCAACCTGCTGTCCTGGGGCCAAGCCATCTCCTTCTCTGCCTGCATGGCACAG
CTCTACTTCTTCGTATTCCTCGGCGCCACCGAGTGCTTTCTCCTGGCCTTCATGGCCTAT
GACCGTTACCTGGCCATCTGCAGCCCACTCCGCTACCCCTTCCTCATGCATCGTGGGCTC
TGTGCCAGGTTGGTGGTGGTCTCCTGGTGCACAGGGGTCAGCACAGGCTTTCTGCCTTCC
CTGATGATTTCCAGGTTGGACTTCTGTGGGCGCAATCAGATTAACCATTTCTTCTGCGAC
CTCCCGCCACTCATGCAGCTCTCCTGTTCCAGAGTTTATATCACCGAGGTGACCATCTTC
ATCCTGTCAATTGCCGTGCTGTGCATTTGTTTTTTTCTGACACTGGGGCCCTATGTTTTC
ATTGTGTCCTCCATATTGAGAATCCCTTCCACCTCTGGCCGGAGAAAGACCTTTTCCACA
TGTGGCTCCCACCTGGCTGTTGTCACTCTCTACTACGGGACCATGATCTCCATGTATGTG
TGTCCCAGTCCCCACCTGTTGCCTGAAATCAACAAGATCATTTCTGTCTTCTACACTGTG
GTCACACCACTGCTGAACCCAGTTATCTACAGCTTGAGGAACAAAGACTTCAAAGAAGCT
GTTAGAAAGGTCATGAGAAGGAAATGTGGTATTCTATGGAGTACAAGTAAAAGGAAGTTC
CTTTAT
Conceptual translation MEPQNTSTVTNFQLLGFQNLLEWQALLFVIFLLIYCLTIIGNVVIITVVSQGLRLHSPMY
MFLQHLSFLEVWYTSTTVPLLLANLLSWGQAISFSACMAQLYFFVFLGATECFLLAFMAY
DRYLAICSPLRYPFLMHRGLCARLVVVSWCTGVSTGFLPSLMISRLDFCGRNQINHFFCD
LPPLMQLSCSRVYITEVTIFILSIAVLCICFFLTLGPYVFIVSSILRIPSTSGRRKTFST
CGSHLAVVTLYYGTMISMYVCPSPHLLPEINKIISVFYTVVTPLLNPVIYSLRNKDFKEA
VRKVMRRKCGILWSTSKRKFLY

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS C/G R/P 1000GP (YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN A/G V/V 1000GP (YRI, YRI, YRI, YRI)
1 247,840,994 247,840,994 SYN A/G V/V 1000GP (CEU)
1 247,841,015 247,841,015 NS G/C N/K 1000GP (CEU)
1 247,841,312 247,841,312 SYN G/A T/T 1000GP (CEU, CHBJPT)
1 247,841,385 247,841,385 NS C/G R/P 1000GP (CEU)
1 247,841,473 247,841,473 NS C/T A/T 1000GP (CEU, CHBJPT)
1 247,841,546 247,841,546 NS G/C F/L 1000GP (CEU, CHBJPT)
1 247,841,575 247,841,575 NS C/T G/S 1000GP (CEU)
1 247,841,582 247,841,582 SYN T/C V/V 1000GP (CEU)
1 248,004,296 248,004,296 SYN A/G V/V rs6681483 (DbSNP)
1 248,004,389 248,004,389 SYN A/G I/I rs72761012 (DbSNP)
1 248,004,614 248,004,614 SYN A/G T/T rs6667389 (DbSNP)
1 248,004,662 248,004,662 SYN G/A C/C rs61748724 (DbSNP)
1 248,004,687 248,004,687 NS C/G R/P rs10888255 (DbSNP)
1 248,004,775 248,004,775 NS C/T A/T rs10888256 (DbSNP)
1 248,004,848 248,004,848 NS C/G L/F rs4607924 (DbSNP)
1 248,004,877 248,004,877 NS C/T G/S rs10888257 (DbSNP)
1 248,004,884 248,004,884 SYN C/T V/V rs1339845 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

N294K R171P A142T F117L G108S G52D % Freq CORP
1 N P T L S G 87.71 0.418
2 N R A F G G 9.68 0.418
3 N R T L G D 1.92 0.418
4 N R T L S G 0.15 0.418
5 N R T L S D 0.15 0.418
6 N P A F G G 0.15 0.418
7 N P A L S G 0.08 0.418
8 K P T L S G 0.08 0.418
9 N R T F G G 0.08 0.418

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR11L1.aApr07-unspliced main_exon 3UTR chr1 247,840,928 247,840,931 -
CDS chr1 247,840,931 247,841,896 -