Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11M1P Olfactory Receptor

Gene Symbol OR11M1P1 (View this gene in GeneCards)
Family 11
Subfamily M
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR12.3.8P, ORL3666
External Ids HGNC: 15333   GeneBank: AF399469, NG_004284   ORDB: ORL3666   
Build #39 labels OR11M1P
Chromosomal location 12:48,627,840-48,628,812 (+)
Cluster 12@49b
Synteny CLIC#30
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11A1 46.18% 301
OR11I1P 48.11% 291

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR11I1 49% 298
Mouse Or11m3 76% 309
Rat Or11m3 77% 300
Cow OR11A12 45% 324
Orang OR11I1P 47% 304
Horse OR11M4P 77% 313
Chimp OR11I1P 48% 304

Expression evidences

Source Accession
GNF Atlas2 40465_at

Sequence information

Nucleotide sequence CCTCTCTTCTCTTGGGCCCAGACCTGGAAGAAGAAGCAGTCCAGTGGTGACAGTGGGAAC
CAGACCACCTGGCTGATCCTAGTGGGCTTCGGGGAGCTGCAATACCTGGGCTTCCTTCCC
TTCACTCTCTTCCTGGCCATCTATGTGGTGACAGTTGGGGGCAATGCCCTCATCATGCTG
GCTGTGGCCTCTAGTCGGACACTGCACCCACCAATGTACTTCTTCCTCTGCCACTTCTCC
CTGCTGGAGATTGGCTATACCTCCAACGTCATACTATGGCTGTTGCAGAGTTTCTTGGAG
GGGAAGGAAGTCATCTCTCTAGTCAGCTGTCTGGCTCAGTTCTACGTGTTTTCCTCGCTG
GCTGCAGCTGAGTGCCTCCTGCTATCTGCCGTGTCCTATGACTGTTACTTGGCCATCTGC
TGCCCCCTTCACTATCCTGCCCTGATGAGCACCTGGTTTTGTCACTGCCTGGCCGCTGGT
GCTTGGTTCAGTGGCTTCTTCTCCTCTGCCTTCACTATGGCCCTGGCAGCACCTCTGTCC
TGGCAGCAGGGAGATTGACCACTATTTCTGTGAGTTTGCTCCAGTAGTCAGGCAGTTCTG
CGGGGATGTGGGAGTCATGTAGGGAGCTGAAGTCAGCATCTCAGGCTTCCTGACACTGGC
CGCCTTCCTACTGATTGTGGCATCCTCTGCCTTCATTGAGGGCTGTACTGCAAATACCCT
CAGGCCATGAGAGGCAGAAAGCCTTCTTCACCTGTTCCTCCCACCTCACCGTAGTTGGGG
TATTTTATGGCACCCTCATTGTGGTCTATGTGGCCCCAATAGAACACATGTCCCCTTGCT
TCTAAAGGTCTTCTCTGTCCTCTACACAGTGTTCACTCCCATGGTCAACTCCATCATCCA
CAGCCTCAAGAACCAAGAGGTGAAGGGGGCTCTGCATAGGCTCAGGGGACAGCTCATCCC
AGGACACACTCAC
Conceptual translation PLFSWAQTWKKKQSSGDSGNQTTWLILVGFGELQYLGFLPFTLFLAIYVVTVGGNALIML
AVASSRTLHPPMYFFLCHFSLLEIGYTSNVILWLLQSFLEGKEVISLVSCLAQFYVFSSL
AAAECLLLSAVSYDCYLAICCPLHYPALMSTWFCHCLAAGAWFSGFFSSAFTMALAAPLS
W\REIDHYFCEFAPVVRQFCGDVGVMXAEVSISGFLTLAAFLLIVASSAFIE\VLQI
PSGHERQKAFFTCSSHLTVVGVFYGTLIVVYVAPIE/HVPLLLKVFSVLYTVFTPMVNS
IIHSLKNQEVKGALHRLRGQLIPGHTH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
12 100 -100 SNP C/T 1000GP (YRI, YRI, YRI)
12 48,628,106 48,628,106 SNP C/A 1000GP (CEU)
12 48,628,115 48,628,115 SNP A/T 1000GP (CEU)
12 48,628,325 48,628,325 SNP G/T 1000GP (CEU)
12 48,628,619 48,628,619 SNP G/A 1000GP (CEU)
12 49,021,713 49,021,712 Ins(1) -/G rs34650671 (DbSNP)
12 49,021,953 49,021,953 SNP C/T rs74089307 (DbSNP)
12 49,022,108 49,022,108 SNP G/T rs7967175 (DbSNP)
12 49,022,402 49,022,402 SNP A/G rs7967542 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
12 49,021,523 49,024,595 CopyNumber #87 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.