Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR11P1P Olfactory Receptor

Gene Symbol OR11P1P1 (View this gene in GeneCards)
Family 11
Subfamily P
Pseudogene Yes
CORP pseudogene probability score
Aliases
External Ids HGNC: 19636   GeneBank: NG_004302   
Build #39 labels OR11P1P
Chromosomal location 14:20,183,925-20,184,298 (-)
Cluster 14@20b
Synteny CLIC#32
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR11H7P 44.66% 103

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Mouse Or11h23 47% 101
Horse OR11F1P 59% 115
Chimp OR11P2P 79% 119

Sequence information

Nucleotide sequence CTGACAGCCTTTCCCTACACCGATGCCACATCTCAGAACATGCACTATGTAAATTTTCTT
ATTATCATTCTCAGTATTTTGTACATCCCTGGACCATATACGTTGATCCTAAGAGCTATG
CTTCAGCTGCTTTCAGCAGCTAGCCATCAAAATGCCTTTTCTATCCGTGGGTCTCACTTA
ATAGTGGTGTCTCTGTTCTGTGAAACCATATGATGATGTGTGTGAATCTCATATCTGACC
ATTTAGTATAAATGAAGATGACAAATCACAATATCATAATGATATCCTCCATAAAGACTC
TAGTTTTAAACTTTGTCAATTACACCTTACTCAATATGAACTTAAAACCTATCTTCAGTT
TTTTTTTTATGGAA
Conceptual translation LTAFPYTDATSQNMHYVNFLIIILSILYIPGPYTLILRAMLQLLSAASHQNAFSIRGSHL
IVVSLFC/NHMMMCVNLISDHLVXKMTNHNIIMISSIKTLVLNFVNYTLLNMNLKPIF
SFFFME

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
14 100 -100 SNP A/G 1000GP (YRI, YRI, YRI, YRI)
14 20,183,985 20,183,985 SNP A/G 1000GP (CEU)
14 20,184,280 20,184,280 SNP T/C 1000GP (CEU)
14 20,184,287 20,184,287 SNP A/C 1000GP (CEU)
14 20,652,144 20,652,144 SNP A/G rs4981803 (DbSNP)
14 20,652,439 20,652,439 SNP C/T rs4981804 (DbSNP)
14 20,652,446 20,652,446 SNP A/C rs4981806 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
14 20,203,125 20,655,466 CopyNumber Variation_34656 (DGV)
14 20,203,125 20,716,841 CopyNumber Variation_8765 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.