Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR12D2 Olfactory Receptor

Gene Symbol OR12D21 (View this gene in GeneCards)
Family 12
Subfamily D
Pseudogene No
CORP pseudogene probability score
Aliases AC004171, dJ994E9.8, hs6M1-20, OR6-28, HsOR6.3.19, ORL367, ORL743, ORL523
External Ids HGNC: 8178   GeneBank: BC069123, BK004523, NM_013936   ORDB: ORL367, ORL743, ORL523   
Build #39 labels OR12D2
Chromosomal location 6:29,396,700-29,397,620 (+)
Cluster 6@29
Synteny CLIC#12
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs2073153)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR12D1P 87.91% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR5F2 47% 304
Chimp CONTIG*********** 98% 307
Mouse Or12d2 80% 306
Rat Or12d2c 79% 306
Cow OR12D2 82% 306
Cow OR12D2IP 82% 306
Cow OR12D2H 81% 306
Cow OR12D2D 82% 306
Cow OR12D2F 81% 306
Cow OR12D2G 80% 306
Cow OR12D2E 81% 306

Expression evidences

Source Accession
ESTs DB324228
mRNA BC069123
GNF Atlas2 221344_at

Sequence information

Nucleotide sequence ATGCTGAATACAACCTCAGTCACCGAATTTCTCCTCTTGGGAGTGACAGACATTCAAGAA
CTGCAGCCTTTTCTCTTCGTGGTTTTCCTCACCATCTACTTCATCAGTGTGACTGGGAAT
GGAGCCGTTCTGATGATTGTCATCTCCGATCCTAGACTCCATTCCCTTATGTATTTCTTC
CTGGGAAACCTGTCCTACCTGGATATCTGTTACTCTACGGTGACACTGCCAAAAATGCTG
CAGAACTTTCTCTCTACACACAAAGCAATTTCTTTCTTGGGATGCATAAGCCAGCTTCAT
TTCTTCCACTTCCTGGGCAGCACGGAGTCCATGTTGTTCGCCGTGATGGCATTTGACCTC
TCTGTGGCTATCTGCAAGCCACTTCGCTACACTGTCATCATGAACCCTCAGCTCTGTACC
CAGATGGCCATCACAATCTGGGTCATTGGTTTTTTCCATGCCCTGCTGCACTCCGTAATG
ACTTCTCGCTTGAACTTCTGTGGTTCCAACCGTATCCATCATTTTCTCTGTGATATTAAG
CCATTGCTAAAGCTGGCCTGTGGGAACACTGAGCTTAATCAGTGGCTACTCAGTACTGTC
ACGGGGACAATTGCCATGGGCCCCTTCTTTCTGACACTTCTCTCCTATTTCTACATTATC
ACTTATCTCTTCTTCAAGACCCGTTCTTGTAGCATGCTCTGTAAAGCACTGTCCACTTGT
GCCTCCCACTTCATGGTAGTTATTCTTTTCTATGCACCTGTTCTTTTCACCTATATCCAT
CCTGCGTTAGAGAGCTTCATGGACCAGGACCGGATTGTTGCCATCATGTACACTGTGGTC
ACTCCTGTACTAAACCCACTGATCTATACTTTGAGGAACAAGGAAGTGAAGGGGGCCTTG
GGTAGAGTGATCAGAAGGCTT
Conceptual translation MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVTGNGAVLMIVISDPRLHSLMYFF
LGNLSYLDICYSTVTLPKMLQNFLSTHKAISFLGCISQLHFFHFLGSTESMLFAVMAFDL
SVAICKPLRYTVIMNPQLCTQMAITIWVIGFFHALLHSVMTSRLNFCGSNRIHHFLCDIK
PLLKLACGNTELNQWLLSTVTGTIAMGPFFLTLLSYFYIITYLFFKTRSCSMLCKALSTC
ASHFMVVILFYAPVLFTYIHPALESFMDQDRIVAIMYTVVTPVLNPLIYTLRNKEVKGAL
GRVIRRL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 NS G/T V/F 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
6 100 -100 SYN G/A L/L 1000GP (YRI, YRI, YRI, YRI, YRI)
6 29,364,539 29,364,539 SYN A/G L/L rs36210738 (DbSNP)
6 29,364,555 29,364,555 NS A/G M/V rs36210739 (DbSNP)
6 29,364,572 29,364,572 SYN C/T I/I rs61453431 (DbSNP)
6 29,364,615 29,364,615 NS G/T V/F rs9257834 (DbSNP)
6 29,364,643 29,364,643 NS C/T P/L rs4987411 (DbSNP)
6 29,364,685 29,364,685 NS A/G Y/C rs36210740 (DbSNP)
6 29,364,695 29,364,695 SYN C/G T/T rs36210741 (DbSNP)
6 29,364,729 29,364,729 NS C/T P/S rs36210742 (DbSNP)
6 29,364,787 29,364,787 NS C/T S/F rs3128853 (DbSNP)
6 29,364,815 29,364,815 NS C/G F/L rs2073154 (DbSNP)
6 29,364,835 29,364,835 NS T/G L/R rs2073153 (DbSNP)
6 29,364,838 29,364,838 NS C/G S/C rs2073152 (DbSNP)
6 29,364,871 29,364,871 NS G/T G/V rs11752608 (DbSNP)
6 29,364,951 29,364,951 NS G/A V/I rs2073151 (DbSNP)
6 29,365,034 29,365,034 SYN C/T A/A rs36211074 (DbSNP)
6 29,365,200 29,365,200 NS C/T P/S rs61742210 (DbSNP)
6 29,365,241 29,365,241 SYN T/C L/L rs2073150 (DbSNP)
6 29,365,325 29,365,325 SYN A/G V/V rs36211075 (DbSNP)
6 29,365,331 29,365,331 NS A/C K/N rs36211076 (DbSNP)
6 29,365,373 29,365,373 SYN C/T A/A rs61737687 (DbSNP)
6 29,396,731 29,396,731 NS T/C L/P 1000GP (CHBJPT)
6 29,396,838 29,396,838 NS G/T V/F 1000GP (CEU, CHBJPT)
6 29,396,866 29,396,866 NS T/C L/P 1000GP (CEU, CHBJPT)
6 29,397,010 29,397,010 NS C/T S/F 1000GP (CEU, CHBJPT)
6 29,397,038 29,397,038 NS C/G F/L 1000GP (CEU, CHBJPT)
6 29,397,058 29,397,058 NS T/G L/R 1000GP (CEU, CHBJPT)
6 29,397,061 29,397,061 NS C/G S/C 1000GP (CEU, CHBJPT)
6 29,397,174 29,397,174 NS G/A V/I 1000GP (CEU, CHBJPT)
6 29,397,182 29,397,182 SYN T/C T/T 1000GP (CHBJPT)
6 29,397,234 29,397,234 NS A/G I/V 1000GP (CHBJPT)
6 29,397,236 29,397,236 NS T/G I/M 1000GP (CHBJPT)
6 29,397,287 29,397,287 SYN A/G L/L 1000GP (CEU, CHBJPT)
6 29,397,449 29,397,449 NS C/G F/L 1000GP (CHBJPT)
6 29,397,464 29,397,464 SYN T/C L/L 1000GP (CEU, CHBJPT)

Variations - CNVs

Chr Start End Type Sources
6 29,363,399 29,364,769 CopyNumber Variation_99478 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

L11P V47F L56P C70Y S85P S104F F113L L120R S121C V132G V159I I179V I179M S242P N285K % Freq CORP
1 L V L C S F F L S V V I I S N 58.68 0.375
2 L F P C S F L R C V I I I S N 19.28 0.016
3 L F P C S F L R S V I I I S N 10.52 0.016
4 L F P C S F L R C V I V M S N 3.15 0.016
5 L V L C S S F L S V V I I S N 2.30 0.375
6 P F P C S F L R S V I I I S N 1.08 0.016
7 L F P C S F L L S V I I I S N 1.00 0.219
8 L V L C S F F L S V V V M S N 0.69 0.375
9 L V L Y S F F L S G V I I S N 0.54 0.375
10 L V L C P F F L S V V I I S N 0.31 0.375
11 L F P C S F F L C V I I I S N 0.31 0.219
12 L F P C S F L R S V I V M S N 0.31 0.016
13 L V L Y S F F L S V V I I S N 0.23 0.375
14 L F P C S F F L S V I I I S N 0.23 0.219
15 L V L C S F F L S V V I I P N 0.23 0.090
16 L F L C S F F L S V V I I S N 0.15 0.375
17 P F P C S F L L S V I I I S N 0.15 0.219
18 L F P C S F L R S V I I I S K 0.15 0.008
19 L F P C S F L R C G I I I S N 0.08 0.016
20 L F L C S F L R C V I V M S N 0.08 0.033
21 L F P C S F F L S V V I I S N 0.08 0.219
22 L V L C P F F L S V V V M S N 0.08 0.375
23 L F P C S F L L C V I I I S N 0.08 0.219
24 L F P C S F L L S V I V M S N 0.08 0.219
25 L F P C S F F L S V I V M S N 0.08 0.219
26 L V P C S F L R C V I I I S N 0.08 0.016
27 L F P C P F L R C V I I I S N 0.08 0.016

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR12D2.aApr07-unspliced main_exon 5UTR chr6 29,396,555 29,396,700 +
CDS chr6 29,396,700 29,397,620 +
3UTR chr6 29,397,620 29,397,671 +
OR12D2.bApr07 exon_5UTR chr6 29,301,588 29,301,787 +
exon_5UTR chr6 29,395,293 29,395,673 +
main_exon CDS_partial chr6 29,397,573 29,397,620 +
3UTR chr6 29,397,620 29,398,134 +