Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR12D3 Olfactory Receptor

Gene Symbol OR12D31 (View this gene in GeneCards)
Family 12
Subfamily D
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases OR6-27, hs6M1-27, bA150A6.1, HsOR6.3.18, ORL1030
External Ids HGNC: 13963   GeneBank: BC069082, BC069154, BK004439, HSA459858, NM_030959   ORDB: ORL1030   
Build #39 labels OR12D3
Chromosomal location 6:29,374,340-29,375,287 (-)
Cluster 6@29
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR12D1P 67.96% 309
OR12D2 66.99% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR10AG66 47% 307
Chimp CONTIG696.50-350 98% 274
Mouse Or12d17 80% 312
Rat Or12d17 79% 317
Cow OR12D3 81% 316

Expression evidences

Source Accession
mRNA AB464427
GNF Atlas2 221431_s_at

Sequence information

Nucleotide sequence ATGGAGAATGTCACTACAATGAATGAGTTTCTTCTACTTGGCCTGACTGGTGTTCAGGAG
CTGCAGCCTTTCTTCTTTGGGATTTTCTTAATCATTTACCTGATAAACTTGATTGGAAAT
GGATCTATATTGGTGATGGTTGTTTTGGAACCACAACTCCACTCCCCTATGTATTTTTTT
CTGGGAAACCTTTCTTGTCTGGATATTTCTTATTCTTCAGTGACACTGCCCAAGCTGCTC
GTAAACCTCGTGTGCAGTCGCAGGGCTATATCTTTTCTAGGCTGTATCACCCAGCTACAC
TTCTTCCACTTTTTGGGAAGCACAGAGGCCATTTTACTGGCTATCATGGCCTTTGACCGT
TTTGTTGCCATCTGCAATCCTCTTCGCTACACTGTCATCATGAACCCCCAGGTGTGTATT
CTGTTGGCAGCTGCGGCCTGGCTCATCAGCTTCTTTTACGCTCTGATGCATTCTGTCATG
ACTGCACACCTGAGTTTTTGTGGCTCTCAGAAACTCAATCACTTCTTCTACGATGTCAAG
CCGCTCTTAGAATTGGCCTGTAGTGACACATTACTCAATCAATGGCTTCTTTCCATTGTC
ACAGGCAGCATATCCATGGGAGCTTTCTTTCTGACTCTTCTCTCCTGCTTCTATGTAATT
GGCTTCCTTCTGTTTAAGAACAGGTCCTGCAGAATACTCCACAAGGCTCTGTCCACTTGT
GCCTCCCATTTTATGGTGGTATGTCTTTTCTATGGACCTGTGGGCTTCACATATATTCGT
CCTGCTTCAGCCACCTCCATGATTCAGGACCGGATAATGGCCATCATGTATAGCGCCGTC
ACCCCTGTACTGAATCCACTAATCTACACCCTTAGGAACAAAGAAGTGATGATGGCTCTG
AAGAAAATCTTTGGTAGGAAGTTGTTTAAAGACTGGCAGCAACACCAC
Conceptual translation MENVTTMNEFLLLGLTGVQELQPFFFGIFLIIYLINLIGNGSILVMVVLEPQLHSPMYFF
LGNLSCLDISYSSVTLPKLLVNLVCSRRAISFLGCITQLHFFHFLGSTEAILLAIMAFDR
FVAICNPLRYTVIMNPQVCILLAAAAWLISFFYALMHSVMTAHLSFCGSQKLNHFFYDVK
PLLELACSDTLLNQWLLSIVTGSISMGAFFLTLLSCFYVIGFLLFKNRSCRILHKALSTC
ASHFMVVCLFYGPVGFTYIRPASATSMIQDRIMAIMYSAVTPVLNPLIYTLRNKEVMMAL
KKIFGRKLFKDWQQHH

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 NS A/G Y/H 1000GP (YRI)
6 100 -100 SYN C/T A/A 1000GP (YRI, YRI)
6 29,342,236 29,342,236 NS A/G Y/H rs9380122 (DbSNP)
6 29,342,630 29,342,630 SYN C/T A/A rs34525583 (DbSNP)
6 29,342,775 29,342,775 NS G/A T/I rs3749971 (DbSNP)
6 29,342,825 29,342,825 SYN G/A L/L rs3749970 (DbSNP)
6 29,374,459 29,374,459 NS A/G Y/H 1000GP (CEU, CHBJPT)
6 29,374,853 29,374,853 SYN C/T A/A 1000GP (CEU, CHBJPT)
6 29,374,998 29,374,998 NS G/A T/I 1000GP (CEU, CHBJPT)
6 29,375,048 29,375,048 SYN G/A L/L 1000GP (CEU, CHBJPT)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Y277H T97I % Freq CORP
1 Y T 86.25 1.000
2 H T 8.60 1.000
3 Y I 5.15 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR12D3.aApr07-unspliced main_exon 3UTR chr6 29,373,423 29,374,340 -
CDS chr6 29,374,340 29,375,287 -
5UTR chr6 29,375,287 29,375,291 -