Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13A1 Olfactory Receptor

Gene Symbol OR13A11 (View this gene in GeneCards)
Family 13
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.03 (functional)
Aliases OR10-3, HsOR10.2.2, ORL3265
External Ids HGNC: 14772   GeneBank: AB065728, BK004287   ORDB: ORL3265   
Build #39 labels OR13A1
Chromosomal location 10:45,303,439-45,304,365 (-)
Cluster 10@46
Synteny CLIC#22
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1F1 45.18% 301
OR1F12 46.15% 299
OR5V1 47% 300

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13A1 87% 308
Chimp CONTIG1777.4-14190 97% 309
Mouse Or13a1 85% 309
Rat Or13a1 83% 308
Cow OR13A1 84% 308

Expression evidences

Source Accession
ESTs DB053156
mRNA AB463955
GNF Atlas2 gnf1h10899_at

Sequence information

Nucleotide sequence ATGATGAGTAACCAGACGTTGGTAACCGAGTTCATCCTGCAGGGCTTTTCGGAGCACCCA
GAATACCGGGTGTTCTTATTCAGCTGTTTCCTCTTCCTCTACTCTGGGGCCCTCACAGGT
AATGTCCTCATCACCTTGGCCATCACGTTCAACCCTGGGCTCCACGCTCCTATGTACTTT
TTCTTACTCAACTTGGCTACTATGGACATTATCTGCACCTCTTCCATCATGCCCAAGGCG
CTGGCCAGTCTGGTGTCGGAAGAGAGCTCCATCTCCTACGGGGGCTGCATGGCCCAGCTC
TATTTCCTCACGTGGGCTGCATCCTCAGAGCTGCTGCTCCTCACGGTCATGGCCTATGAC
CGGTACGCAGCCATCTGCCACCCGCTGCATTACAGCAGCATGATGAGCAAGGTGTTCTGC
AGCGGGCTGGCCACAGCCGTGTGGCTGCTCTGCGCCGTCAACACGGCCATCCACACGGGG
CTGATGCTGCGCTTGGATTTCTGTGGCCCCAATGTCATTATCCATTTCTTCTGCGAGGTC
CCTCCCCTGCTGCTTCTCTCCTGCAGCTCCACCTACGTCAACGGTGTCATGATTGTCCTG
GCGGATGCTTTCTACGGCATAGTGAACTTCCTGATGACCATCGCGTCCTATGGCTTCATC
GTCTCCAGCATCCTGAAGGTGAAGACTGCCTGGGGGAGGCAGAAAGCCTTCTCCACCTGC
TCTTCCCACCTCACCGTGGTGTGCATGTATTACACCGCTGTCTTCTACGCCTACATAAGC
CCGGTCTCTGGCTACAGCGCAGGGAAGAGCAAGTTGGCTGGCCTGCTGTACACTGTGCTG
AGTCCTACCCTCAACCCCCTCATCTATACTTTGAGAAACAAGGAGGTCAAAGCAGCCCTC
AGGAAGCTTTTCCCTTTCTTCAGAAAT
Conceptual translation MMSNQTLVTEFILQGFSEHPEYRVFLFSCFLFLYSGALTGNVLITLAITFNPGLHAPMYF
FLLNLATMDIICTSSIMPKALASLVSEESSISYGGCMAQLYFLTWAASSELLLLTVMAYD
RYAAICHPLHYSSMMSKVFCSGLATAVWLLCAVNTAIHTGLMLRLDFCGPNVIIHFFCEV
PPLLLLSCSSTYVNGVMIVLADAFYGIVNFLMTIASYGFIVSSILKVKTAWGRQKAFSTC
SSHLTVVCMYYTAVFYAYISPVSGYSAGKSKLAGLLYTVLSPTLNPLIYTLRNKEVKAAL
RKLFPFFRN

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
10 100 -100 NS G/A A/V 1000GP (YRI, YRI, YRI, YRI)
10 100 -100 SYN A/G S/S 1000GP (YRI)
10 45,798,918 45,798,918 NS A/G V/A rs60779198 (DbSNP)
10 45,799,066 45,799,065 Ins(1) -/A rs35302355 (DbSNP)
10 45,799,195 45,799,195 NS C/T V/I rs73281136 (DbSNP)
10 45,799,451 45,799,451 SYN C/T R/R rs17157674 (DbSNP)
10 45,799,592 45,799,592 SYN A/G S/S rs11239431 (DbSNP)
10 45,799,679 45,799,679 SYN A/G T/T rs7350388 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 82 (Hasin)
10 45,550,145 45,820,136 CopyNumber Variation_9148 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A318V I226V G113R % Freq CORP
1 A I G 89.94 0.093
2 A V G 4.60 0.093
3 A I R 4.02 0.093
4 V I G 1.44 0.093

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR13A1.aApr07 main_exon 3UTR chr10 45,303,358 45,303,439 -
CDS chr10 45,303,439 45,304,365 -
5UTR chr10 45,304,365 45,304,500 -
exon_5UTR chr10 45,307,426 45,307,459 -
OR13A1.bApr07 main_exon 3UTR chr10 45,302,654 45,303,439 -
CDS chr10 45,303,439 45,304,365 -
5UTR chr10 45,304,365 45,304,434 -
exon_5UTR chr10 45,307,426 45,307,567 -
exon_5UTR chr10 45,307,739 45,307,808 -
exon_5UTR chr10 45,315,524 45,315,607 -