Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13C2 Olfactory Receptor

Gene Symbol OR13C21 (View this gene in GeneCards)
Family 13
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.1 (functional)
Aliases OR9-12, HsOR9.4.7, ORL3228
External Ids HGNC: 14701   GeneBank: AB065709, BK004408, NM_001004481   ORDB: ORL3228   
Build #39 labels OR13C2
Chromosomal location 9:104,604,674-104,605,627 (-)
Cluster 9@107
Synteny CLIC#19
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13C5 92.77% 318
OR13C9 91.51% 318

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13C2 90% 318
Dog OR13C2B 91% 313
Chimp CONTIG378.169-5457 91% 318
Chimp CONTIG378.165-46322 92% 318
Mouse Or13c7b 69% 314
Rat Or13c9 81% 313
Cow OR13C2 88% 318
Cow OR13C2E 88% 318
Cow OR13C2D 87% 318
Cow OR13C2C 86% 318

Expression evidences

Source Accession
mRNA AB529292
GNF Atlas2 gnf1h02222_s_at

Sequence information

Nucleotide sequence ATGGAATGGGAAAACCACACCATTCTGGTGGAATTTTTTCTGAAGGGACTTTCTGGTCAC
CCAAGACTTGAGTTACTCTTTTTTGTGCTCATCTTCATAATGTATGTGGTCATCCTTCTG
GGGAATGGTACTCTCATTTTAATCAGCATCTTGGACCCTCACCTTCACACCCCTATGTAC
TTCTTTCTGGGGAACCTCTCCTTCTTGGACATCTGCTACACCACCACCTCTATTCCCTCC
ACGCTAGTGAGCTTCCTTTCAGAAAGAAAGACCATTTCCCTTTCTGGCTGTGCAGTGCAG
ATGTTCCTCGGCTTGGCCATGGGGACAACAGAGTGTGTGCTTCTGGGCATGATGGCCTTT
GACCGCTATGTGGCTATCTGCAACCCTCTGAGATATCCCATCATCATGAGTAAGGATGCC
TATGTACCCATGGCAGCTGGGTCCTGGATCATAGGAGCTGTCAATTCTGCAGTACAATCA
GTGTTTGTGGTACAATTGCCTTTCTGCAGGAATAACATCATCAATCATTTCACCTGTGAA
ATTCTGGCTGTCATGAAACTGGCCTGTGCTGACATCTCAGACAATGAGTTCATCATGCTT
GTGGCCACAACATTGTTCATATTGACACCTTTGTTATTAATCATTGTCTCTTACACGTTA
ATCATTGTGAGCATCTTCAAAATTAGCTCTTCCGAGGGGAGAAGCAAAGCTTCCTCTACC
TGTTCAGCCCATCTGACTGTGGTCATAATATTCTATGGGACCATCCTCTTCATGTACATG
AAGCCCAAGTCTAAAGAGACACTTAATTCGGATGACTTGGATGCTACCGACAAAATTATA
TCCATGTTCTATGGGGTGATGACTCCCATGATGAATCCTTTAATCTACAGTCTTAGAAAC
AAGGATGTGAAAGAGGCAGTAAAACACCTACTGAACAGAAGGTTCTTTAGCAAG
Conceptual translation MEWENHTILVEFFLKGLSGHPRLELLFFVLIFIMYVVILLGNGTLILISILDPHLHTPMY
FFLGNLSFLDICYTTTSIPSTLVSFLSERKTISLSGCAVQMFLGLAMGTTECVLLGMMAF
DRYVAICNPLRYPIIMSKDAYVPMAAGSWIIGAVNSAVQSVFVVQLPFCRNNIINHFTCE
ILAVMKLACADISDNEFIMLVATTLFILTPLLLIIVSYTLIIVSIFKISSSEGRSKASST
CSAHLTVVIIFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLRN
KDVKEAVKHLLNRRFFSK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 SYN G/A Y/Y 1000GP (YRI)
9 104,604,851 104,604,851 SYN G/A Y/Y 1000GP (CEU, CHBJPT)
9 104,605,150 104,605,150 NS A/T S/T 1000GP (CEU)
9 107,367,008 107,367,008 NS C/T E/K rs10156474 (DbSNP)
9 107,367,132 107,367,132 SYN A/G Y/Y rs10820679 (DbSNP)
9 107,367,318 107,367,318 NS G/T F/L rs72730657 (DbSNP)
9 107,367,393 107,367,396 In-Del(4) -/TAAC rs60058604 (DbSNP)
9 107,367,396 107,367,399 In-Del(4) -/TAAC rs71991336 (DbSNP)
9 107,367,431 107,367,431 NS A/T S/T rs1851716 (DbSNP)
9 107,367,612 107,367,612 SYN C/T V/V rs55706329 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 5 (Hasin)
9 107,359,802 107,384,394 CopyNumber Variation_2829 (DGV)
9 107,359,990 107,369,323 CopyNumber Variation_22820 (DGV)
9 107,360,837 107,368,182 CopyNumber Variation_100735 (DGV)
9 107,361,236 107,368,044 CopyNumber Variation_83131 (DGV), Variation_96222 (DGV)
9 107,361,236 107,370,284 CopyNumber Variation_96224 (DGV)
9 107,361,236 107,379,709 CopyNumber Variation_96223 (DGV)
9 107,361,609 107,369,324 CopyNumber Variation_65480 (DGV)
9 107,362,211 107,369,310 CopyNumber Variation_33147 (DGV)
9 107,364,955 107,368,008 Deletion #303 (Waszak)
9 107,366,028 107,368,359 CopyNumber Variation_63139 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

F257V S229R I181L % Freq CORP
1 F S I 96.74 0.134
2 V S I 1.90 0.134
3 F S L 0.95 0.134
4 F R I 0.41 0.134

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR13C2.aApr07-unspliced main_exon 3UTR chr9 104,604,671 104,604,674 -
CDS chr9 104,604,674 104,605,627 -