Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13C4 Olfactory Receptor

Gene Symbol OR13C41 (View this gene in GeneCards)
Family 13
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.06 (functional)
Aliases OR9-7, HsOR9.4.2, ORL3223
External Ids HGNC: 14722   GeneBank: AB065714, AF399602, BK004411, NM_001001919   ORDB: ORL3223   
Build #39 labels OR13C4
Chromosomal location 9:104,526,256-104,527,209 (-)
Cluster 9@107
Synteny CLIC#19
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13C3 83.91% 317

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13C4 89% 318
Chimp CONTIG378.162-1638 98% 318
Mouse Or13c3 82% 316
Rat Or13c3b 81% 316
Rat Or13c3 81% 316
Rat Or13c3c 81% 316
Rat Or13c3g 80% 316
Cow OR13C4 89% 318

Expression evidences

Source Accession
mRNA AB463956
GNF Atlas2 gnf1h05171_at

Sequence information

Nucleotide sequence ATGGACAAGATAAACCAGACATTTGTGAGAGAATTCATTCTTCTGGGACTCTCTGGTTAC
CCCAAACTTGAGATCATTTTCTTTGCTCTGATTCTAGTTATGTACGTAGTGATTCTAATT
GGCAATGGTGTTCTGATCATAGCAAGCATCTTGGATTCTCGTCTTCACATGCCCATGTAC
TTCTTCCTGGGCAACCTCTCTTTCCTGGATATCTGCTATACAACCTCCTCCATTCCCTCA
ACACTGGTGAGCTTAATCTCAAAGAAAAGAAACATTTCCTTCTCTGGATGTGCAGTGCAG
ATGTTCTTTGGGTTTGCAATGGGGTCAACAGAATGTTTCCTCCTTGGCATGATGGCATTT
GATCGTTATGTGGCCATCTGTAACCCTCTGAGATACCCCATCATCATGAACAAGGTGGTG
TATGTACTGCTGACTTCTGTATCATGGCTTTCTGGTGGAATCAATTCAACTGTGCAAACA
TCACTTGCCATGCGATGGCCTTTCTGTGGGAACAATATTATTAATCATTTCTTATGCGAG
ATCTTAGCTGTCCTAAAATTAGCTTGTTCTGATATATCTGTCAATATTGTTACCCTAGCA
GTGTCAAATATTGCTTTCCTAGTTCTTCCTCTGCTCGTGATTTTTTTCTCCTATATGTTC
ATCCTCTACACCATCTTGCGAACGAACTCGGCCACAGGAAGACACAAGGCATTTTCTACA
TGCTCAGCTCACCTGACTGTGGTGATCATATTTTATGGTACCATCTTCTTTATGTATGCA
AAACCTAAGTCCCAGGACCTCCTTGGGAAAGACAACTTGCAAGCTACAGAGGGGCTTGTT
TCCATGTTTTATGGGGTTGTGACCCCCATGTTAAACCCCATAATCTATAGCTTGAGAAAT
AAAGATGTAAAAGCTGCTATAAAATATTTGCTGAGCAGGAAAGCTATTAACCAG
Conceptual translation MDKINQTFVREFILLGLSGYPKLEIIFFALILVMYVVILIGNGVLIIASILDSRLHMPMY
FFLGNLSFLDICYTTSSIPSTLVSLISKKRNISFSGCAVQMFFGFAMGSTECFLLGMMAF
DRYVAICNPLRYPIIMNKVVYVLLTSVSWLSGGINSTVQTSLAMRWPFCGNNIINHFLCE
ILAVLKLACSDISVNIVTLAVSNIAFLVLPLLVIFFSYMFILYTILRTNSATGRHKAFST
CSAHLTVVIIFYGTIFFMYAKPKSQDLLGKDNLQATEGLVSMFYGVVTPMLNPIIYSLRN
KDVKAAIKYLLSRKAINQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 104,526,259 104,526,259 NS G/C N/K 1000GP (CHBJPT)
9 104,526,305 104,526,305 NS T/C D/G 1000GP (CHBJPT)
9 104,526,433 104,526,433 nonsense SNP A/C Y/* 1000GP (CHBJPT)
9 104,526,451 104,526,451 SYN A/G G/G 1000GP (CHBJPT)
9 104,526,673 104,526,673 SYN G/A C/C 1000GP (CEU)
9 104,526,714 104,526,714 NS A/G W/R 1000GP (CEU)
9 107,288,648 107,288,647 Ins(1) -/G rs35941351 (DbSNP)
9 107,288,751 107,288,751 NS A/G V/A rs10991292 (DbSNP)
9 107,288,995 107,288,995 NS A/G W/R rs41277753 (DbSNP)
9 107,289,352 107,289,352 NS T/C I/V rs61738891 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 161 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

N317K D302G Y259* F220S W166R G43D % Freq CORP
1 N D Y F W G 97.31 0.078
2 N G Y F W G 1.00 0.078
3 K D * F W G 0.69 1.200
4 N D Y F R G 0.69 0.078
5 N D Y S W G 0.15 0.078
6 N D Y F W D 0.15 0.078

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR13C4.aApr07-unspliced main_exon 3UTR chr9 104,526,253 104,526,256 -
CDS chr9 104,526,256 104,527,209 -