Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13C5 Olfactory Receptor

Gene Symbol OR13C51 (View this gene in GeneCards)
Family 13
Subfamily C
Pseudogene No
CORP pseudogene probability score
Aliases OR9-11, HsOR9.4.6, ORL3222
External Ids HGNC: 15100   GeneBank: AB065710, BK004409, NM_001004482   ORDB: ORL3222   
Build #39 labels OR13C5
Chromosomal location 9:104,598,460-104,599,413 (-)
Cluster 9@107
Synteny CLIC#19
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13C2 92.77% 318

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13C2 86% 318
Dog OR13C2B 88% 313
Chimp CONTIG378.165-46322 97% 318
Mouse Or13c7b 67% 314
Rat Or13c9 77% 313
Cow OR13C2 86% 318
Cow OR13C2D 86% 318
Cow OR13C2E 86% 318
Cow OR13C2C 84% 318

Expression evidences

Source Accession
mRNA BC136842
GNF Atlas2 gnf1h11219_at

Sequence information

Nucleotide sequence ATGGAATGGGAAAACCACACCATTCTGGTGGAATTTTTTCTGAAGGGACTTTCTGGTCAC
CCAAGACTTGAGTTACTCTTTTTTGTGCTCATCTTCATAATGTATGTGGTCATCCTTCTG
GGGAATGGTACTCTCATTTTAATCAGCATCTTGGACCCTCACCTTCACACCCCTATGTAC
TTCTTTCTGGGGAACCTCTCCTTCTTGGACATCTGCTACACCACCACCTCTATTCCCTCC
ACGCTAGTGAGCTTCCTTTCAGAAAGAAAGACCATTTCCCTTTCTGGCTGTGCAGTGCAG
ATGTTCCTCAGCTTGGCCATGGGGACAACAGAGTGTGTGCTTCTGGGCGTGATGGCCTTT
GACCGCTATGTGGCTATCTGCAACCCTCTGAGATATCCCATCATCATGAGTAAGGATGCC
TATGTACCCATGGCAGCTGGGTCCTGGATCATAGGAGCTGTCAATTCTGCAGTACAAACA
GTGTTTGTGGTACAATTGCCTTTCTGCAGGAATAACATCATCAATCATTTCACCTGTGAA
ATTCTAGCTGTCATGAAACTGGCCTGTGCTGACATCTCAGGCAATGAGTTCATCCTGCTT
GTGACCACAACATTGTTCCTATTGACACCTTTGTTATTAATTATTGTCTCTTACACGTTA
ATCATTTTGAGCATCTTCAAAATTAGCTCTTCGGAGGGGAGAAGCAAACCTTCCTCTACC
TGCTCAGCTCGTCTGACTGTGGTGATAACATTCTGTGGGACCATCTTCCTCATGTACATG
AAGCCCAAGTCTCAAGAGACACTTAATTCAGATGACTTGGATGCCACTGACAAACTTATA
TTCATATTCTACAGGGTGATGACTCCCATGATGAATCCTTTAATCTACAGTCTTAGAAAC
AAGGATGTGAAGGAGGCAGTAAAACACCTACTGAGAAGAAAAAATTTTAACAAG
Conceptual translation MEWENHTILVEFFLKGLSGHPRLELLFFVLIFIMYVVILLGNGTLILISILDPHLHTPMY
FFLGNLSFLDICYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAF
DRYVAICNPLRYPIIMSKDAYVPMAAGSWIIGAVNSAVQTVFVVQLPFCRNNIINHFTCE
ILAVMKLACADISGNEFILLVTTTLFLLTPLLLIIVSYTLIILSIFKISSSEGRSKPSST
CSARLTVVITFCGTIFLMYMKPKSQETLNSDDLDATDKLIFIFYRVMTPMMNPLIYSLRN
KDVKEAVKHLLRRKNFNK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS G/A A/V 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
9 104,598,545 104,598,545 NS A/G M/T 1000GP (CEU, CHBJPT)
9 104,598,570 104,598,570 NS T/C I/V 1000GP (CEU, CHBJPT)
9 104,598,641 104,598,641 NS A/G M/T 1000GP (CEU, CHBJPT)
9 104,598,830 104,598,830 NS T/C N/S 1000GP (CHBJPT)
9 104,598,848 104,598,848 NS C/T C/Y 1000GP (CEU, CHBJPT)
9 107,360,769 107,360,769 Del(1) -/T rs11314210 (DbSNP)
9 107,360,826 107,360,826 NS G/A T/M rs1851725 (DbSNP)
9 107,360,828 107,360,827 Ins(1) -/G rs34164968 (DbSNP)
9 107,360,851 107,360,851 NS T/C I/V rs1523678 (DbSNP)
9 107,360,910 107,360,910 NS A/G L/P rs7852858 (DbSNP)
9 107,360,922 107,360,922 NS G/A T/M rs1851724 (DbSNP)
9 107,361,009 107,361,009 NS C/G S/T rs73508187 (DbSNP)
9 107,361,111 107,361,111 NS C/T S/N rs6479259 (DbSNP)
9 107,361,129 107,361,129 NS T/C Y/C rs4117966 (DbSNP)
9 107,361,217 107,361,217 NS A/T S/T rs73509723 (DbSNP)
9 107,361,295 107,361,295 NS C/T V/I rs41297189 (DbSNP)
9 107,361,312 107,361,312 NS T/C N/S rs1851723 (DbSNP)
9 107,361,346 107,361,346 NS C/T V/M rs2417534 (DbSNP)
9 107,361,386 107,361,386 SYN A/G L/L rs72730658 (DbSNP)
9 107,361,398 107,361,398 SYN C/T V/V rs72500630 (DbSNP)
9 107,361,424 107,361,424 NS A/T S/T rs72500631 (DbSNP)
9 107,361,439 107,361,439 NS C/G V/L rs4629933 (DbSNP)
9 107,361,460 107,361,460 NS A/G S/P rs73508191 (DbSNP)
9 107,361,490 107,361,490 NS A/T L/M rs7042502 (DbSNP)
9 107,361,599 107,361,599 NS C/G L/F rs6479260 (DbSNP)
9 107,361,642 107,361,642 NS G/A S/F rs1851722 (DbSNP)
9 107,361,691 107,361,690 Ins(1) -/C rs35965091 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 75 (Hasin)
9 107,359,802 107,384,394 CopyNumber Variation_2829 (DGV)
9 107,359,990 107,369,323 CopyNumber Variation_22820 (DGV)
9 107,360,837 107,368,182 CopyNumber Variation_100735 (DGV)
9 107,361,236 107,364,253 CopyNumber Variation_83130 (DGV)
9 107,361,236 107,365,760 CopyNumber Variation_96225 (DGV)
9 107,361,236 107,368,044 CopyNumber Variation_83131 (DGV), Variation_96222 (DGV)
9 107,361,236 107,370,284 CopyNumber Variation_96224 (DGV)
9 107,361,236 107,379,709 CopyNumber Variation_96223 (DGV)
9 107,361,609 107,369,324 CopyNumber Variation_65480 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M290T I282V P262L M258T S231L S229T N195S C189Y A188T V117M S104G % Freq CORP
1 M I P M S S N C A V S 30.88 0.620
2 M I P T S S N C A V S 23.73 0.620
3 T V P T S S N Y A M S 19.66 0.629
4 T V P T S S S Y A M S 10.52 0.629
5 T V P T S S N C A M S 3.69 0.620
6 T V L T S S N C A M S 3.23 0.620
7 M I P M S S N C A V G 3.00 0.620
8 T V P T S S N Y A V S 2.30 0.629
9 M I P T S T N C A V S 1.46 0.620
10 T V P T S S S Y A V S 0.31 0.629
11 T V P T L S S Y A M S 0.15 0.629
12 M V P T S S S Y A M S 0.15 0.629
13 M I P T S T S C A V S 0.15 0.620
14 M I P T S S N C T V S 0.08 0.620
15 T I P T S S N Y A M S 0.08 0.629
16 T V L T S S N C A V S 0.08 0.620
17 M I P M S S N Y A M G 0.08 0.629
18 M V P T S S N Y A M S 0.08 0.629
19 M I P T S S S Y A M S 0.08 0.629
20 T V P T L S S Y A V S 0.08 0.629
21 M I P M S S N Y A M S 0.08 0.629
22 T V P T S S N C A V S 0.08 0.620
23 T I P M S S N C A V S 0.08 0.620

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR13C5.aApr07-unspliced main_exon 3UTR chr9 104,598,457 104,598,460 -
CDS chr9 104,598,460 104,599,413 -