Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13C8 Olfactory Receptor

Gene Symbol OR13C81 (View this gene in GeneCards)
Family 13
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.06 (functional)
Aliases OR9-10, HsOR9.4.4, ORL3225
External Ids HGNC: 15103   GeneBank: AB065711, AF399599, BK004607, NM_001004483   ORDB: ORL3225   
Build #39 labels OR13C8
Chromosomal location 9:104,569,168-104,570,127 (+)
Cluster 9@107
Synteny CLIC#19
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13C1P 67.08% 319
OR13C7P 68.65% 319
OR2S2 66.67% 318

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13C8 86% 319
Chimp CONTIG378.165-17075 98% 320
Mouse Or13c25 79% 318
Rat Or13c25 77% 317
Cow OR13C8 86% 319

Expression evidences

Source Accession
mRNA AB463957
GNF Atlas2 gnf1h05172_at

Sequence information

Nucleotide sequence ATGGAAAGGACCAACGATTCCACGTCGACAGAATTTTTCCTGGTAGGGCTTTCTGCCCAC
CCAAAGCTCCAGACAGTTTTCTTCGTTCTAATTTTGTGGATGTACCTGATGATCCTGCTT
GGAAATGGAGTCCTTATCTCAGTTATCATCTTTGATTCTCACCTGCACACCCCCATGTAT
TTCTTCCTCTGTAATCTTTCCTTCCTCGACGTTTGCTACACAAGTTCCTCTGTCCCACTA
ATTCTTGCCAGCTTTCTGGCAGTAAAGAAAAAGGTTTCCTTCTCTGGGTGTATGGTGCAA
ATGTTTATTTCTTTTGCCATGGGGGCCACGGAGTGCATGATCTTAGGCACGATGGCACTG
GACCGCTATGTGGCCATCTGCTACCCACTGAGATACCCTGTCATCATGAGCAAGGGTGCC
TATGTGGCCATGGCAGCTGGGTCCTGGGTCACTGGGCTTGTGGACTCAGTAGTGCAGACA
GCTTTTGCAATGCAGTTACCATTCTGTGCTAATAATGTCATTAAACATTTTGTCTGTGAA
ATTCTGGCTATCTTGAAACTGGCCTGTGCTGATATTTCAATCAATGTGATTAGTATGACA
GGGTCGAATCTGATTGTTCTGGTTATTCCATTGTTAGTAATTTCCATCTCTTACATATTT
ATTGTTGCCACTATTCTGAGGATTCCTTCCACTGAAGGAAAACATAAGGCCTTCTCCACC
TGCTCAGCCCACCTGACAGTGGTGATTATATTCTATGGAACCATCTTCTTCATGTACGCA
AAGCCTGAGTCTAAAGCCTCTGTTGATTCAGGTAATGAAGACATCATTGAGGCCCTCATC
TCCCTTTTCTATGGAGTGATGACTCCCATGCTTAATCCTCTCATCTATAGTCTGCGAAAC
AAGGATGTAAAGGCTGCTGTCAAAAACATACTGTGTAGGAAAAACTTTTCTGATGGAAAA
Conceptual translation MERTNDSTSTEFFLVGLSAHPKLQTVFFVLILWMYLMILLGNGVLISVIIFDSHLHTPMY
FFLCNLSFLDVCYTSSSVPLILASFLAVKKKVSFSGCMVQMFISFAMGATECMILGTMAL
DRYVAICYPLRYPVIMSKGAYVAMAAGSWVTGLVDSVVQTAFAMQLPFCANNVIKHFVCE
ILAILKLACADISINVISMTGSNLIVLVIPLLVISISYIFIVATILRIPSTEGKHKAFST
CSAHLTVVIIFYGTIFFMYAKPESKASVDSGNEDIIEALISLFYGVMTPMLNPLIYSLRN
KDVKAAVKNILCRKNFSDGK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS C/A A/D 1000GP (YRI, YRI)
9 104,569,223 104,569,223 NS C/A A/D 1000GP (CEU, CHBJPT)
9 104,569,857 104,569,857 SYN C/T S/S 1000GP (CEU)
9 107,331,504 107,331,504 NS A/C D/A rs7026705 (DbSNP)
9 107,332,041 107,332,041 NS C/G T/S rs10991304 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

D6N S9* A19D H20Y V92L G96R K175N F238V I310K % Freq CORP
1 D S D H V G K F I 59.98 0.124
2 D S A H V G K F I 35.10 0.124
3 D S D H V G N F I 1.08 0.124
4 D S A H V G K F K 1.00 0.124
5 D S D Y V G K F I 0.84 0.124
6 N S D H V G K F I 0.69 0.124
7 D * D H V G K F I 0.61 1.200
8 D S D H L G K F I 0.31 0.124
9 D S D H V R K F I 0.23 0.124
10 D S A H V R K F I 0.08 0.124
11 D S D H V G K V I 0.08 0.205

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR13C8.aApr07-unspliced main_exon CDS chr9 104,569,168 104,570,127 +
3UTR chr9 104,570,127 104,570,130 +