Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13C9 Olfactory Receptor

Gene Symbol OR13C91 (View this gene in GeneCards)
Family 13
Subfamily C
Pseudogene No
CORP pseudogene probability score 0.06 (functional)
Aliases OR9-13, HsOR9.4.8, ORL3226
External Ids HGNC: 15104   GeneBank: AB065672, AB065708, BK004250, NM_001001956   ORDB: ORL3226   
Build #39 labels OR13C9
Chromosomal location 9:104,617,251-104,618,204 (-)
Cluster 9@107
Synteny CLIC#19
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13C2 91.51% 318

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13C2 93% 318
Dog OR13C2B 91% 313
Chimp CONTIG378.169-5457 96% 318
Mouse Or13c9 84% 281
Rat Or13c9 84% 313
Cow OR13C2D 86% 318
Cow OR13C2 86% 318
Cow OR13C2E 86% 318
Cow OR13C2C 85% 318

Expression evidences

Source Accession
mRNA AB463958
GNF Atlas2 gnf1h02214_at
GNF Atlas2 gnf1h02215_s_at

Sequence information

Nucleotide sequence ATGGAATGGGAAAACCAAACCATTCTGGTGGAATTTTTTCTGAAGGGACATTCTGTTCAC
CCAAGGCTTGAGTTACTCTTTTTTGTGCTAATCTTCATAATGTATGTGGTCATCCTTCTG
GGGAATGGTACTCTCATTTTAATCAGCATCTTGGACCCTCACCTTCACACCCCTATGTAC
TTCTTTCTGGGGAACCTCTCCTTCTTGGACATCTGCTACACCACCACCTCTATTCCCTCC
ACACTAGTGAGCTTCCTTTCAGAAAGAAAGACCATTTCCTTTTCTGGCTGTGCAGTGCAG
ATGTTCCTTGGCTTGGCCATGGGGACAACAGAGTGTGTGCTTCTGGGCATGATGGCCTTT
GACCGCTATGTGGCTATCTGCAACCCTCTGAGATATCCCATCATCATGAGCAAGAATGCC
TATGTACCCATGGCTGTTGGGTCCTGGTTTGCAGGGATTGTCAACTCTGCAGTACAAACT
ACATTTGTAGTACAATTGCCTTTCTGCAGGAAGAATGTCATCAATCATTTCTCATGTGAA
ATTCTAGCTGTCATGAAGTTGGCCTGTGCTGACATCTCAGGCAATGAGTTCCTCATGCTT
GTGGCCACAATATTGTTCACATTGATGCCACTGCTCTTGATAGTTATCTCTTACTCATTA
ATCATTTCCAGCATCCTCAAGATTCACTCCTCTGAGGGGAGAAGCAAAGCTTTCTCTACC
TGCTCAGCCCATCTGACTGTGGTCATAATATTCTATGGGACCATCCTCTTCATGTATATG
AAGCCCAAGTCTAAAGAGACACTTAATTCAGATGACTTGGATGCTACCGACAAAATTATA
TCCATGTTCTATGGGGTGATGACTCCCATGATGAATCCTTTAATCTACAGTCTTAGAAAC
AAGGATGTGAAAGAGGCAGTAAAACACCTACCGAACAGAAGGTTCTTTAGCAAG
Conceptual translation MEWENQTILVEFFLKGHSVHPRLELLFFVLIFIMYVVILLGNGTLILISILDPHLHTPMY
FFLGNLSFLDICYTTTSIPSTLVSFLSERKTISFSGCAVQMFLGLAMGTTECVLLGMMAF
DRYVAICNPLRYPIIMSKNAYVPMAVGSWFAGIVNSAVQTTFVVQLPFCRKNVINHFSCE
ILAVMKLACADISGNEFLMLVATILFTLMPLLLIVISYSLIISSILKIHSSEGRSKAFST
CSAHLTVVIIFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLRN
KDVKEAVKHLPNRRFFSK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS G/T F/L 1000GP (YRI, YRI, YRI, YRI, YRI)
9 100 -100 SYN A/G L/L 1000GP (YRI)
9 104,617,263 104,617,263 NS C/A R/S 1000GP (CHBJPT)
9 104,617,614 104,617,614 NS G/T F/L 1000GP (CEU, CHBJPT)
9 104,617,896 104,617,896 SYN A/G L/L 1000GP (CEU, CHBJPT)
9 104,617,934 104,617,934 NS T/A T/S 1000GP (CEU, CHBJPT)
9 104,618,115 104,618,115 SYN T/G L/L 1000GP (CEU, CHBJPT)
9 104,618,133 104,618,133 NS C/A E/D 1000GP (CEU, CHBJPT)
9 107,379,895 107,379,895 NS G/T F/L rs10761054 (DbSNP)
9 107,380,177 107,380,177 SYN A/G L/L rs1813819 (DbSNP)
9 107,380,215 107,380,215 NS A/T S/T rs993658 (DbSNP)
9 107,380,379 107,380,379 NS A/G V/A rs61322228 (DbSNP)
9 107,380,396 107,380,396 SYN G/T L/L rs36091517 (DbSNP)
9 107,380,414 107,380,414 NS A/C D/E rs2900373 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 76 (Hasin)
9 107,359,802 107,384,394 CopyNumber Variation_2829 (DGV)
9 107,361,236 107,379,709 CopyNumber Variation_96223 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R314S A306G S230P F197L V146I R122C A98S T91S V36A E24D % Freq CORP
1 R A S F V R A T V E 33.49 0.078
2 R A S F V R A S V D 30.34 0.078
3 R A S L V R A T V E 23.04 0.078
4 R A S F V R A T V D 5.53 0.078
5 R A S F V R A T A D 2.69 0.078
6 R G S F V C A T V E 1.38 0.602
7 R A S F I R A T V D 1.23 0.078
8 R A S F V C A T V E 0.84 0.602
9 S A S L V R A T V E 0.69 0.078
10 R A S F V R A S V E 0.38 0.078
11 R A S L V R A S V D 0.15 0.078
12 R A P L V R A T V E 0.08 0.078
13 R A S F V R S T V E 0.08 0.078
14 R A S F V R S S V D 0.08 0.078

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR13C9.aApr07-unspliced main_exon 3UTR chr9 104,617,248 104,617,251 -
CDS chr9 104,617,251 104,618,204 -