Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13D1 Olfactory Receptor

Gene Symbol OR13D11 (View this gene in GeneCards)
Family 13
Subfamily D
Pseudogene No
CORP pseudogene probability score 0.16 (functional)
Aliases OR9-15, HsOR9.4.11, ORL3242
External Ids HGNC: 14695   GeneBank: AB065671, BK004251, NM_001004484   ORDB: ORL3242   
Build #39 labels OR13D1
Chromosomal location 9:104,694,518-104,695,459 (+)
Cluster 9@107
Synteny CLIC#19
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13D3P 86.31% 314

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13D3 88% 314
Dog OR13D1B 88% 313
Mouse Or13d1 86% 314
Rat Or13d1 85% 310
Cow OR13D1P 84% 311
Orang OR13D1P 94% 316
Horse OR13D34P 75% 316
Chimp OR13D3P 85% 314

Expression evidences

Source Accession
mRNA AB587601
GNF Atlas2 gnf1h02218_at

Sequence information

Nucleotide sequence ATGGAGACAAGAAATTACTCTGCCATGACTGAATTCTTTCTGGTGGGGCTTTCCCAATAT
CCAGAGCTCCAGCTTTTTCTGTTCCTGCTCTGCCTCATCATGTACATGATAATCCTCCTG
GGAAATAGCCTCCTCATTATCATCACCATCTTGGATTCTCGCCTCCATACTCCCATGTAT
TTCTTTCTTGGAAACCTCTCATTCTTGGACATCTGTTACACATCCTCATCCATTCCTCCA
ATGCTTATTATATTTATGTCTGAGAGAAAATCCATCTCCTTCATTGGCTGTGCTCTGCAG
ATGGTTGTGTCCCTTGGCTTGGGCTCCACTGAGTGTGTCCTCCTGGCTGTGATGGCCTAT
GACCACTATGTGGCCATCTGCAACCCACTGAGGTACTCCATCATCATGAACGGAGTGCTG
TATGTGCAAATGGCTGCATGGTCCTGGATCATAGGCTGTCTGACCTCCCTATTGCAAACA
GTTCTGACAATGATGTTGCCTTTCTGTGGGAATAATGTCATTGATCATATTACCTGTGAA
ATTTTGGCCCTTCTAAAACTTGTTTGTTCAGATATCACCATCAATGTGCTTATCATGACA
GTGACAAATATTGTTTCACTGGTGATTCTTCTACTGTTAATTTTCATCTCCTATGTGTTT
ATTCTCTCTTCCATCCTGAGAATTAATTGTGCTGAGGGAAGAAAGAAAGCCTTCTCTACC
TGTTCAGCGCACTCGATTGTGGTCATCTTATTCTACGGTTCAGCCCTTTTTATGTACATG
AAACCCAAGTCAAAGAACACTAATACATCTGATGAGATTATTGGGCTGTCTTATGGAGTG
GTAAGCCCAATGTTAAATCCCATCATCTATAGCCTCAGGAATAAAGAGGTCAAAGAGGCT
GTAAAGAAAGTCCTGAGCAGACATCTGCATTTATTGAAAATG
Conceptual translation METRNYSAMTEFFLVGLSQYPELQLFLFLLCLIMYMIILLGNSLLIIITILDSRLHTPMY
FFLGNLSFLDICYTSSSIPPMLIIFMSERKSISFIGCALQMVVSLGLGSTECVLLAVMAY
DHYVAICNPLRYSIIMNGVLYVQMAAWSWIIGCLTSLLQTVLTMMLPFCGNNVIDHITCE
ILALLKLVCSDITINVLIMTVTNIVSLVILLLLIFISYVFILSSILRINCAEGRKKAFST
CSAHSIVVILFYGSALFMYMKPKSKNTNTSDEIIGLSYGVVSPMLNPIIYSLRNKEVKEA
VKKVLSRHLHLLKM

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS A/C Q/H 1000GP (YRI, YRI, YRI, YRI)
9 100 -100 SYN C/T L/L 1000GP (YRI, YRI, YRI)
9 104,694,652 104,694,652 SYN C/T L/L 1000GP (CEU, CHBJPT)
9 104,694,994 104,694,994 NS A/C Q/H 1000GP (CEU, CHBJPT)
9 104,695,051 104,695,051 SYN C/T T/T 1000GP (CHBJPT)
9 104,695,251 104,695,251 NS C/T S/L 1000GP (CEU, CHBJPT)
9 104,695,444 104,695,444 SYN G/A L/L 1000GP (CEU, CHBJPT)
9 107,456,841 107,456,841 NS A/G M/V rs73663505 (DbSNP)
9 107,456,928 107,456,928 NS C/T L/F rs56017313 (DbSNP)
9 107,456,933 107,456,933 SYN C/T L/L rs12347076 (DbSNP)
9 107,457,039 107,457,039 NS A/G M/V rs56241491 (DbSNP)
9 107,457,275 107,457,275 NS A/C Q/H rs10820709 (DbSNP)
9 107,457,332 107,457,332 SYN C/T T/T rs61742675 (DbSNP)
9 107,457,376 107,457,376 NS C/T T/I rs61735916 (DbSNP)
9 107,457,532 107,457,532 NS C/T S/L rs10761073 (DbSNP)
9 107,457,686 107,457,686 NS G/T E/D rs61733820 (DbSNP)
9 107,457,725 107,457,725 SYN A/G L/L rs12338899 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

I127M T142A G170R Q191H T225I S277L E328D % Freq CORP
1 I T G H T L E 44.47 0.799
2 I T G Q T L E 26.88 0.799
3 I T G Q T S E 25.88 0.799
4 I T R H T L E 0.84 0.799
5 I T G H T L D 0.61 0.799
6 I T G Q I S E 0.61 0.542
7 I A G Q T S E 0.23 0.799
8 I T G H T S E 0.23 0.799
9 M T G Q T L E 0.23 0.799

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR13D1.aApr07-unspliced main_exon 5UTR chr9 104,694,422 104,694,518 +
CDS chr9 104,694,518 104,695,459 +
3UTR chr9 104,695,459 104,695,462 +