Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13D2P Olfactory Receptor

Gene Symbol OR13D2P1 (View this gene in GeneCards)
Family 13
Subfamily D
Pseudogene Yes
CORP pseudogene probability score
Aliases OR9-9, HsOR9.4.5P, ORL326
External Ids HGNC: 15105   GeneBank: AF399467, BK004606, NG_004380   ORDB: ORL326   
Build #39 labels OR13D2P
Chromosomal location 9:104,590,017-104,590,950 (+)
Cluster 9@107
Synteny CLIC#19
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR13C3 61.72% 303
OR13C4 60.7% 313
OR13D1 64.82% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13D2 90% 311
Chimp CONTIG378.165-37704 100% 311
Mouse Or13d1 65% 313
Rat Or13d1 66% 303
Cow OR13D2 89% 305
Cow OR13D2C 83% 311
Cow OR13D2DP 86% 273

Expression evidences

Source Accession
GNF Atlas2 gnf1h10935_at

Sequence information

Nucleotide sequence ATGGAAAGGACCAATTGGACAGAGATAGAGTTCATTCTGCAAGGACTTTCAGGGTACCCA
AGAGCTGAAAAATTCCTTTTCGTGATGTGCTTAGTGATGTACCTGGTGATTCTCCTAGGT
AATGGCACCTTGATCATTCTGACACTCCTGGATGCTCGTCTCCACACACCCATGTACTTC
TTCCTTGGGAATCTTTCCTTCCTAGACATTTGGTACACATCCTCCTCCATCCCCTCAATG
CTGATACACTTCCTATCAGAGAAGAAAACCATCTCCTTCACTAGATGTGTGATTCAAATG
TCTGTCTCTTACACTATGGGATCCACCGAGTGTGTGCTTCTAGCAGTGATGGCATATGAC
CGTTATGTAGCCATCTGCAACCCTCTGAGATATCCCATCATCATGGGCAAGGCACTTTGT
ATTCAGATGGTGGCTGTCTCTTGGGGACTAGGCTTTCTCAACTCATTGACAGAAACTGTT
CTTGCAATACGGTTACCCTTCTGTGGAAAAAAATGTCATTAATCATTTTGTTTGTGAAAT
ATTGGCCTTTGTCAAGCTGGCTTGCACAGATACTTCCTTGAATGAGATTATTATAATGTT
GGGCAATGTAATATTTTTGTTTTCTCCATTACTGCTGATTTGTATCTCCTACATCTTTAT
CCTTTCTACTGTACTAAGAATCAATTCAGCTGAAGGAAGGAAAAAGGCCTTTTCCACCTG
CTCAGCCCACATGACAGTGGTGATTGTGTTTTATGGGACAATCCTCTTCATGTACATGAA
GGCAAAGTCCAAAGACTCTGCTTTTGACAAACTGATTGCCCTGTTCTATGGCATAGTCAC
CCCCATGCTCAATCCTATCATCTATAGCCTGAGGAATACAGAGGTGCATGGAGCTATGAG
GAAATTAATGAGTAGACCCTGGTTCTGGAGGAAA
Conceptual translation MERTNWTEIEFILQGLSGYPRAEKFLFVMCLVMYLVILLGNGTLIILTLLDARLHTPMYF
FLGNLSFLDIWYTSSSIPSMLIHFLSEKKTISFTRCVIQMSVSYTMGSTECVLLAVMAYD
RYVAICNPLRYPIIMGKALCIQMVAVSWGLGFLNSLTETVLAIRLPFCGK\VINHFVCE
ILAFVKLACTDTSLNEIIIMLGNVIFLFSPLLLICISYIFILSTVLRINSAEGRKKAFST
CSAHMTVVIVFYGTILFMYMKAKSKDSAFDKLIALFYGIVTPMLNPIIYSLRNTEVHGAM
RKLMSRPWFWRK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 SNP T/C 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
9 104,590,136 104,590,136 SNP T/G 1000GP (CEU, CHBJPT)
9 104,590,344 104,590,344 SNP G/A 1000GP (CEU, CHBJPT)
9 107,352,323 107,352,323 SNP C/T rs58443492 (DbSNP)
9 107,352,417 107,352,417 SNP G/T rs6479256 (DbSNP)
9 107,352,625 107,352,625 SNP A/G rs13291813 (DbSNP)
9 107,352,699 107,352,699 SNP C/T rs73519623 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.