Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13F1 Olfactory Receptor

Gene Symbol OR13F11 (View this gene in GeneCards)
Family 13
Subfamily F
Pseudogene No
CORP pseudogene probability score 0.27 (functional)
Aliases OR9-6, HsOR9.4.1, ORL3229
External Ids HGNC: 14723   GeneBank: AB065715, BK004412, NM_001004485   ORDB: ORL3229   
Build #39 labels OR13F1
Chromosomal location 9:104,504,263-104,505,219 (+)
Cluster 9@107
Synteny CLIC#19
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2K2 65.12% 301

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13F1 82% 319
Dog OR13F1B 85% 308
Chimp CONTIG378.158-10935 96% 319
Mouse Or13f5 80% 319
Rat Or13f5 83% 286
Cow OR13F1 79% 308
Cow OR13F1C 81% 275

Expression evidences

Source Accession
mRNA AB529294
GNF Atlas2 gnf1h05175_at

Sequence information

Nucleotide sequence ATGTTCCCGGCAAATTGGACATCTGTAAAAGTATTTTTCTTCCTGGGATTTTTTCACTAC
CCCAAAGTTCAGGTCATCATATTTGCGGTGTGCTTGCTGATGTACCTGATCACCTTGCTG
GGCAACATTTTTCTGATCTCCATCACCATTCTAGATTCCCACCTGCACACCCCTATGTAC
CTCTTCCTCAGCAATCTCTCCTTTCTGGACATCTGGTACTCCTCTTCTGCCCTCTCTCCA
ATGCTGGCAAACTTTGTTTCAGGGAGAAACACTATTTCATTCTCAGGGTGCGCCACTCAG
ATGTACCTCTCCCTTGCCATGGGCTCCACTGAGTGTGTGCTCCTGCCCATGATGGCATAT
GACCGGTATGTGGCCATCTGCAACCCCCTGAGATACCCTGTCATCATGAATAGGAGAACC
TGTGTGCAGATTGCAGCTGGCTCCTGGATGACAGGCTGTCTCACTGCCATGGTGGAAATG
ATGTCTGTGCTGCCACTGTCTCTCTGTGGTAATAGCATCATCAATCATTTCACTTGTGAA
ATTCTGGCCATCTTGAAATTGGTTTGTGTGGACACCTCCCTGGTGCAGTTAATCATGCTG
GTGATCAGTGTACTTCTTCTCCCCATGCCAATGCTACTCATTTGTATCTCTTATGCATTT
ATCCTCGCCAGTATCCTGAGAATCAGCTCAGTGGAAGGTCGAAGTAAAGCCTTTTCAACG
TGCACAGCCCACCTGATGGTGGTAGTTTTGTTCTATGGGACGGCTCTCTCCATGCACCTG
AAGCCCTCCGCTGTAGATTCACAGGAAATAGACAAATTTATGGCTTTGGTGTATGCCGGA
CAAACCCCCATGTTGAATCCTATCATCTATAGTCTACGGAACAAAGAGGTGAAAGTGGCC
TTGAAAAAATTGCTGATTAGAAATCATTTTAATACTGCCTTCATTTCCATCCTCAAA
Conceptual translation MFPANWTSVKVFFFLGFFHYPKVQVIIFAVCLLMYLITLLGNIFLISITILDSHLHTPMY
LFLSNLSFLDIWYSSSALSPMLANFVSGRNTISFSGCATQMYLSLAMGSTECVLLPMMAY
DRYVAICNPLRYPVIMNRRTCVQIAAGSWMTGCLTAMVEMMSVLPLSLCGNSIINHFTCE
ILAILKLVCVDTSLVQLIMLVISVLLLPMPMLLICISYAFILASILRISSVEGRSKAFST
CTAHLMVVVLFYGTALSMHLKPSAVDSQEIDKFMALVYAGQTPMLNPIIYSLRNKEVKVA
LKKLLIRNHFNTAFISILK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS T/C F/L 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
9 100 -100 SYN C/G A/A 1000GP (YRI, YRI)
9 104,504,315 104,504,315 NS T/C F/S 1000GP (CEU, CHBJPT)
9 104,504,345 104,504,345 NS T/C F/S 1000GP (CHBJPT)
9 104,504,493 104,504,493 SYN C/G A/A 1000GP (CEU, CHBJPT)
9 104,504,552 104,504,552 NS G/A C/Y 1000GP (CEU)
9 104,504,563 104,504,563 NS A/G M/V 1000GP (CEU, CHBJPT)
9 104,504,662 104,504,662 NS G/A V/I 1000GP (CEU, CHBJPT)
9 104,505,023 104,505,023 NS C/T T/M 1000GP (CEU, CHBJPT)
9 104,505,071 104,505,071 NS T/C I/T 1000GP (CEU, CHBJPT)
9 107,266,577 107,266,577 NS C/T L/F rs28553883 (DbSNP)
9 107,266,596 107,266,596 NS C/T S/F rs7049042 (DbSNP)
9 107,266,694 107,266,694 SYN C/T L/L rs61748307 (DbSNP)
9 107,266,742 107,266,742 NS A/T T/S rs12380064 (DbSNP)
9 107,266,774 107,266,774 SYN C/G A/A rs1949755 (DbSNP)
9 107,266,813 107,266,813 SYN C/T N/N rs61754949 (DbSNP)
9 107,266,824 107,266,824 NS C/T S/F rs7018553 (DbSNP)
9 107,266,844 107,266,844 NS G/A V/M rs1403812 (DbSNP)
9 107,266,909 107,266,909 SYN A/G R/R rs41277751 (DbSNP)
9 107,266,943 107,266,943 NS G/A V/I rs1403811 (DbSNP)
9 107,267,236 107,267,235 Ins(1) -/G rs35123854 (DbSNP)
9 107,267,304 107,267,304 NS C/T T/M rs7030820 (DbSNP)
9 107,267,352 107,267,352 NS C/T T/I rs7847413 (DbSNP)
9 107,267,420 107,267,420 NS C/T R/W rs7858601 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

F12L L15R F18S F28S G88A F94S C97Y M101V V134I C141S T254M I270T I270M R293W % Freq CORP
1 F L S F G F C V I C M I I R 51.23 0.621
2 F L S F G F C V I C T T I R 21.12 0.515
3 F L F F G F C M V C T I I R 20.58 0.515
4 F L S F G F C V I C T I I R 2.92 0.515
5 F L S S G F C V I C T I I R 0.84 0.515
6 L L F F G F C M V C T I I R 0.77 0.515
7 F L S F G F Y V I C M I I R 0.54 0.993
8 F L S F G F C V I C T T I W 0.46 0.515
9 F L S F G F C V I C T T M R 0.46 0.515
10 F L S F G F C M I C M I I R 0.15 0.621
11 F R S F G F C V I C T T I R 0.15 0.515
12 F L S F G S C V I C M I I R 0.15 0.621
13 F L S F G F C V I C M T I R 0.08 0.621
14 F L S F G F C V I C M T M R 0.08 0.621
15 F L S F A F C V I C M I I R 0.08 0.621
16 F L F F G F C V I C M I I R 0.08 0.621
17 F L F F G S C V I C M I I R 0.08 0.621
18 F L S F G F C V I C M T I W 0.08 0.621
19 F L S F G F C V V C M I I R 0.08 0.621
20 F L S F G F C V I S T T I R 0.08 0.515

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR13F1.aApr07-unspliced main_exon CDS chr9 104,504,263 104,505,219 +
3UTR chr9 104,505,219 104,505,222 +