Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR13K1P Olfactory Receptor

Gene Symbol OR13K1P1 (View this gene in GeneCards)
Family 13
Subfamily K
Pseudogene Yes
CORP pseudogene probability score
Aliases HsORX.1.6P, ORL4073
External Ids HGNC: 14721   GeneBank: NG_004632   ORDB: ORL4073   
Build #39 labels OR13K1P
Chromosomal location X:131,562,729-131,563,812 (+)
Cluster X@131b
Synteny CLIC#48
Remarks Disrupted by Line repeat

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR2AF1P 51.38% 325

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR13K7P 68% 328
Chimp CONTIG3111.19-2876 86% 362
Mouse Or13d1 45% 330
Rat Or13d1 45% 330
Cow OR13K8P 64% 335

Sequence information

Nucleotide sequence ATGGATATTCTGGTTATTGATAATGGCAGTGAAGTGACAGAGTTCATCCTGGTGGGTTTG
TACAACCATCCAAAATTTCAGATTGCCTTTTATCGCACCATGGTAGTGGTCTACCTGATC
ACATTTGTTGGTAGCAGTCTCATTATTGTTGTGGTTAAAGTTGATGGGTGGCTTCACACT
CCTATGTGTTTTTTCCTAAGCAACCTGTCCTTCCTTGATATCTGCTACTCCAGCAATTCA
GTACCTTTTTTGTTGTTCAATGGCTTAAGAGACTACCCCACCATTTCCTATAACAGCTGT
TATGCCCAGATGACCAGTGCTTTTTTTCTGGGGATGACAGGGTGTCTTCTCCTTGCTGTC
ATGGCTTATGAGAGATTTGTTGTGATCTCCAATCCCCTGCGCTACATCATCATTATGAAC
AATAAGGTCTGCATACAGTTGGCCATGGTGACCTGGGCCAGTGCCTTCCTTATGTCATTA
ATACAATAATTGCAATAATACATTGCAATAATACATTAATTGCAATGATTGCATTGCAAT
TCCTGCCCATTTTTGTGGACACAATGTCATCAACCATTTTACCTGTGAGGTGCAGGAATT
GTTGAAGCTTGTCTGCTCAGACATCCCAGGCAGCCTCATCCTCGGTCTAGTCATCGGCAT
ATTCACCTTGTCCCTGCCCTTCACCTTGCCCCTGCCCTTCACCTTCATCCTCTTCGCCTA
TGCTCACATTGTGGTTGCTGTGCTGAGGATCAACTCTGCAGAGGCCAGACTCAAAGCTTT
CTCCACCTGTGGATCCCATCTGACTGTGATCATCATATTTTATGGGACAGCCACCTACAT
GTACTTGAAACCTCAGTCAAGGGAATCCCAAGATGAGGGTAAAGTCATCTCTGTATTTTT
TTTGAAAGTAGAGAAGCAACATCAAAATGATAGCATCTCTGTATTTTATGGTGTTGTGAC
CCCTATGTTGAACCCCCTCATTTACACCTTGAGAGACAAGGATGCGAAAA
Conceptual translation MDILVIDNGSEVTEFILVGLYNHPKFQIAFYRTMVVVYLITFVGSSLIIVVVKVDGWLHT
PMCFFLSNLSFLDICYSSNSVPFLLFNGLRDYPTISYNSCYAQMTSAFFLGMTGCLLLAV
MAYERFVVISNPLRYIIIMNNKVCIQLAMVTWASAFLMSLIQXQXIAIIHX/MI/
IAIPAHFCGHNVINHFTCEVQELLKLVCSDIPGSLILGLVIGIFTLSLPFTLPLPFTFIL
FAYAHIVVAVLRINSAEARLKAFSTCGSHLTVIIIFYGTATYMYLKPQSRESQDEGKVIS
VFFLEKQHQNDSISVFYGVVTPMLNPLIYTLRDKDAK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
X 130,697,489 130,697,489 SNP C/G rs61742427 (DbSNP)
X 130,697,692 130,697,692 SNP G/A rs2874451 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 147 (Hasin)
X 130,696,603 130,699,786 Deletion #317 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.