Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR14A2 Olfactory Receptor

Gene Symbol OR14A21 (View this gene in GeneCards)
Family 14
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.01 (functional)
Aliases HsOR1.5.8
External Ids HGNC: 15024   
Build #39 labels OR5AX1
Chromosomal location 1:247,723,102-247,724,043 (-)
Cluster 1@248
Synteny CLIC#0
Remarks Belongs to OR14- a new family which is expanded in opossum and platypus. Was previously classified into family 5 with the symbol OR5AX1.

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR14A16 56.25% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR14J1B 50% 318
Chimp CONTIG*********** 97% 314
Mouse Or14a260 74% 305
Rat Or14a257b 72% 305
Cow OR14J1 51% 309

Expression evidences

Source Accession
ESTs BE672444
mRNA AB529268
GNF Atlas2 gnf1h10652_at

Sequence information

Nucleotide sequence ATGGCCAATGTCACCTTGGTGACAGGATTTCTTCTTATGGGGTTTTCTAATATCCAGAAG
CTGCGGATTTTATATGGTGTGCTCTTCCTACTGATTTACCTGGCAGCCCTAATGAGTAAC
CTTCTCATCATTACTCTCATTACCCTGGACGTAAAGCTCCAAACACCCATGTACTTCTTC
CTGAAGAACTTATCCTTTTTGGATGTCTTCCTGGTGTCTGTTCCAATCCCAAAATTCATT
GTCAACAACCTAACCCACAACAATTCCATTTCCATTCTAGGATGTGCCTTCCAGCTACTT
TTAATGACTTCCTTCTCAGCAGGAGAGATATTTATCCTCACTGCCATGTCCTATGACCGC
TATGTAGCCATCTGCTGTCCCCTGAACTACGAGGTAATCATGAATACTGGAGTCTGTGTG
TTAATGGCAAGTGTTTCCTGGGCCATTGGAGGGCTCTTTGGTACTGCGTACACAGCTGGC
ACATTTTCCATGCCTTTCTGTGGCTCCAGTGTGATTCCACAGTTTTTCTGTGATGTTCCT
TCATTACTAAGGATTTCCTGTTCTGAAACACTAATGGTAATTTATGCAGGTATTGGAGTT
GGTGCATGTTTAAGCATTTCTTGTTTCATCTGTATTGTGATCTCTTACATTTATATCTTC
TCCACTGTACTGAAGATCCCTACCACTAAAGGTCAGTCCAAAGCTTTTTCCACATGCTTC
CCCCATCTCACTGTTTTCACTGTTTTTATCATAACTGCTTATTTTGTTTATCTTAAGCCA
CCTTCAAATTCACCATCTGTTATTGACAGGCTGCTTTCTGTGATCTACACTGTGATGCCT
CCAGTATTTAACCCTGTAACCTACAGCCTGCGGAACAATGACATGAAATGTGCTCTGATA
AGGTTGCTGCAGAAAACATATGGTCAGGAGGCTTACTTCATT
Conceptual translation MANVTLVTGFLLMGFSNIQKLRILYGVLFLLIYLAALMSNLLIITLITLDVKLQTPMYFF
LKNLSFLDVFLVSVPIPKFIVNNLTHNNSISILGCAFQLLLMTSFSAGEIFILTAMSYDR
YVAICCPLNYEVIMNTGVCVLMASVSWAIGGLFGTAYTAGTFSMPFCGSSVIPQFFCDVP
SLLRISCSETLMVIYAGIGVGACLSISCFICIVISYIYIFSTVLKIPTTKGQSKAFSTCF
PHLTVFTVFIITAYFVYLKPPSNSPSVIDRLLSVIYTVMPPVFNPVTYSLRNNDMKCALI
RLLQKTYGQEAYFI

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS G/A P/S 1000GP (YRI, YRI, YRI, YRI)
1 247,723,191 247,723,191 NS G/A P/S 1000GP (CEU)
1 247,723,313 247,723,313 NS G/A T/I 1000GP (CEU)
1 247,723,647 247,723,647 NS T/C I/V 1000GP (CEU)
1 247,723,700 247,723,700 NS G/A A/V 1000GP (CHBJPT)
1 247,886,493 247,886,493 SNP A/G rs62619787 (DbSNP)
1 247,886,505 247,886,505 SNP G/T rs62619785 (DbSNP)
1 247,886,615 247,886,615 SNP A/G rs11809582 (DbSNP)
1 247,886,949 247,886,949 SNP C/T rs36075193 (DbSNP)
1 247,887,002 247,887,002 SNP A/G rs11204577 (DbSNP)
1 247,887,069 247,887,069 SNP C/G rs1338393 (DbSNP)
1 247,887,122 247,887,122 SNP A/G rs56268113 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

P285S P281T T244I S233F V140L I133V A115V P75L % Freq CORP
1 P P T S V I A P 78.34 0.011
2 P P T S V I V P 5.68 0.011
3 P P T S V V A P 5.53 0.011
4 P P I S V I A P 4.69 0.011
5 S P I S V I A P 4.38 0.279
6 P T I S V I A P 0.69 0.020
7 P P T F V I A P 0.38 0.011
8 P P T S L I A P 0.08 0.011
9 S P T S V I A P 0.08 0.279
10 P P T S V V A L 0.08 0.011
11 P P T S V I A L 0.08 0.011

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
7tm_1.13.aApr07 main_exon CDS_partial chr1 247,723,766 247,724,043 -
5UTR chr1 247,724,043 247,724,062 -
exon_5UTR chr1 247,733,283 247,733,324 -
OR5AX1andOR6F1.eApr07 main_exon chr1 247,722,957 247,723,234 -
main_exon chr1 247,723,353 247,723,454 -
main_exon 3UTR chr1 247,722,957 247,723,102 -
CDS_partial chr1 247,723,102 247,723,234 -
CDS_partial chr1 247,723,353 247,723,454 -
CDS_partial chr1 247,723,651 247,723,761 -