Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR14I1 Olfactory Receptor

Gene Symbol OR14I11 (View this gene in GeneCards)
Family 14
Subfamily I
Pseudogene No
CORP pseudogene probability score 0.8 (pseudogene)
Aliases HsOR1.5.50
External Ids HGNC: 19575   
Build #39 labels OR5BU1P
Chromosomal location 1:248,681,372-248,682,304 (-)
Cluster 1@248
Synteny CLIC#0
Remarks Belongs to OR14- a new family which is expanded in opossum and platypus. Was previously classified into family 5 with the symbol OR5BU1.

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR14C36 49.35% 308
OR14A16 53.64% 302
OR14A2 48.53% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR14I2 78% 310
Chimp CONTIG2148.2-13781 97% 311
Mouse Or14p1 51% 303
Rat Or14p1 51% 301
Cow OR14J1 49% 311

Expression evidences

Source Accession
ESTs AI911102
mRNA BC137189

Sequence information

Nucleotide sequence ATGGACAATCTCACAAAAGTGACAGAATTCCTGCTGATGGAGTTTTCTGGTATCTGGGAG
CTGCAGGTGCTGCACGCCGGGCTGTTTCTGCTGATTTATCTGGCAGTGCTGGTGGGGAAC
CTGCTCATCATTGCAGTCATCACTCTCGATCAGCATCTTCACACACCCATGTACTTCTTC
CTGAAGAACCTCTCCGTTTTGGATCTGTGCTACATCTCAGTCACTGTGCCTAAATCCATC
CGTAACTCCCTGACTCGCAGAAGCTCCATCTCTTATCTTGGCTGTGTGGCTCAAGTCTAT
TTTTTCTCTGCCTTTGCATCTGCTGAGCTGGCCTTCCTTACTGTCATGTCTTATGACCGC
TATGTTGCCATTTGCCACCCCCTCCAATACAGAGCCGTGATGACATCAGGAGGGTGCTAT
CAGATGGCAGTCACCACCTGGCTAAGCTGCTTTTCCTACGCAGCCGTCCACACTGGCAAC
ATGTTTCGGGAGCACGTTTGCAGATCCAGTGTGATCCACCAGTTCTTCCGTGACATCCCT
CATGTGTTGGCCCTGGTTTCCTGTGAGGTTTTCTTTGTAGAGTTTTTGACCCTGGCCCTG
AGCTCATGCTTGGTTCTGGGATGCTTTATTCTCATGATGATCTCCTATTTCCAAATCTTC
TCAACGGTGCTCAGAATCCCTTCAGGACAGAGTCGAGCAAAAGCCTTCTCCACCTGCTCC
CCCCAGCTCATTGTCATCATGCTCTTTCTTACCACAGGGCTCTTTGCTGCCTTAGGACCA
ATTGCAAAAGCTCTGTCCATTCAGGATTTAGTGATTGCTCTGACATACACAGTTTTGCCT
CCCTTCCTCAATCCCATCATATATAGTCTTAGGAATAAGGAGATTAAAACAGCCATGTGG
AGACTCTTTGTGAAGATATATTTTCTGCAAAAG
Conceptual translation MDNLTKVTEFLLMEFSGIWELQVLHAGLFLLIYLAVLVGNLLIIAVITLDQHLHTPMYFF
LKNLSVLDLCYISVTVPKSIRNSLTRRSSISYLGCVAQVYFFSAFASAELAFLTVMSYDR
YVAICHPLQYRAVMTSGGCYQMAVTTWLSCFSYAAVHTGNMFREHVCRSSVIHQFFRDIP
HVLALVSCEVFFVEFLTLALSSCLVLGCFILMMISYFQIFSTVLRIPSGQSRAKAFSTCS
PQLIVIMLFLTTGLFAALGPIAKALSIQDLVIALTYTVLPPFLNPIIYSLRNKEIKTAMW
RLFVKIYFLQK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 NS A/T V/E 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
1 100 -100 SYN G/A S/S 1000GP (YRI, YRI)
1 248,681,658 248,681,658 NS T/C Y/C 1000GP (CEU, CHBJPT)
1 248,681,796 248,681,796 NS C/T S/N 1000GP (CEU, CHBJPT)
1 248,682,055 248,682,055 NS G/T L/M 1000GP (CEU, CHBJPT)
1 248,682,110 248,682,110 SYN G/A S/S 1000GP (CEU, CHBJPT)
1 248,682,157 248,682,157 NS C/T D/N 1000GP (CEU, CHBJPT)
1 248,682,170 248,682,170 SYN T/C A/A 1000GP (CEU, CHBJPT)
1 248,682,198 248,682,198 NS A/G V/A 1000GP (CEU, CHBJPT)
1 248,844,959 248,844,959 SNP C/T rs55871516 (DbSNP)
1 248,845,097 248,845,097 SNP T/C rs2000390 (DbSNP)
1 248,845,356 248,845,356 SNP G/T rs41311583 (DbSNP)
1 248,845,411 248,845,411 SNP A/G rs11485825 (DbSNP)
1 248,845,458 248,845,458 SNP C/T rs4509608 (DbSNP)
1 248,845,471 248,845,471 SNP C/T rs4575113 (DbSNP)
1 248,845,499 248,845,499 SNP A/G rs4462184 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 248,060,959 249,167,690 CopyNumber Variation_8354 (DGV)
1 248,500,109 248,865,374 CopyNumber Variation_3340 (DGV)
1 248,522,680 249,158,239 CopyNumber Variation_8355 (DGV)
1 248,687,510 248,865,377 CopyNumber Variation_0017 (DGV)
1 248,701,948 248,877,423 CopyNumber Variation_2056 (DGV)
1 248,837,759 248,882,120 CopyNumber Variation_34798 (DGV)
1 248,842,825 248,845,785 CopyNumber Variation_6819 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V304E Y216C V205L S170N L84M D50N V36A % Freq CORP
1 V Y V N L N A 73.20 0.851
2 V C V S M D A 11.21 1.000
3 V Y V S L D V 7.45 0.851
4 E C V S L D A 2.53 1.000
5 V Y V N M D A 2.07 0.851
6 V Y V S L D A 0.84 0.851
7 V Y V S L N A 0.69 0.851
8 V Y L S L D V 0.46 0.851
9 V C V S L N A 0.38 1.000
10 V Y V S M D A 0.31 0.851
11 V C V S M N A 0.15 1.000
12 V Y V N L D V 0.15 0.851
13 V Y V S M N A 0.15 0.851
14 V C V S L D V 0.08 1.000
15 V Y V S L N V 0.08 0.851
16 E Y V N L N A 0.08 0.851
17 V Y V N L D A 0.08 0.851
18 V Y V N L N V 0.08 0.851

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5BU1.aApr07-unspliced main_exon 3UTR chr1 248,681,124 248,681,372 -
CDS chr1 248,681,372 248,682,304 -