Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR14J1 Olfactory Receptor

Gene Symbol OR14J11 (View this gene in GeneCards)
Family 14
Subfamily J
Pseudogene No
CORP pseudogene probability score 0.09 (functional)
Aliases hs6M1-28, bA150A6.4, HsOR6.3.16
External Ids HGNC: 13971   
Build #39 labels OR5U1
Chromosomal location 6:29,306,690-29,307,652 (+)
Cluster 6@29
Synteny CLIC#0
Remarks Belongs to OR14- a new family which is expanded in opossum and platypus. Was previously classified into family 5 with the symbol OR5U1.

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR14A16 51.77% 311
OR14L1P 51.9% 289
OR14A2 49.84% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR14J1B 83% 320
Dog OR14J1 83% 320
Chimp CONTIG*********** 99% 321
Mouse Or14j6 62% 305
Rat Or14j1 80% 320
Cow OR14J1 88% 321

Expression evidences

Source Accession
mRNA BC136905
GNF Atlas2 gnf1h10950_at

Sequence information

Nucleotide sequence ATGGTCAATTTGACTTCAATGAGTGGATTCCTTCTTATGGGGTTTTCTGATGAGCGTAAG
CTTCAGATTTTACATGCATTGGTATTTCTGGTGACATACCTGCTGGCCTTGACAGGCAAC
CTCCTCATTATCACCATCATTACCGTGGACCGTCGTCTCCATTCCCCCATGTATTACTTT
TTAAAGCACCTCTCTCTTCTGGACCTCTGCTTCATCTCTGTCACAGTCCCCCAGTCCATT
GCAAATTCACTTATGGGCAACGGTTACATTTCTCTTGTTCAGTGCATTCTTCAGGTTTTC
TTCTTCATAGCTCTGGCCTCATCAGAAGTGGCCATTCTCACAGTGATGTCTTATGACAGG
TACGCAGCAATCTGTCAACCACTTCATTATGAGACTATTATGGATCCCCGTGCCTGTAGG
CATGCAGTGATAGCTGTGTGGATTGCTGGGGGCCTCTCTGGGCTCATGCATGCTGCCATT
AACTTCTCCATACCTCTCTGTGGGAAGAGAGTCATTCACCAATTCTTCTGTGATGTTCCT
CAGATGCTGAAACTAGCCTGTTCTTATGAATTCATTAATGAGATTGCACTGGCTGCATTC
ACAACGTCTGCAGCATTTATCTGTTTGATCTCCATTGTGCTCTCCTACATTCGCATCTTC
TCTACAGTGCTGAGAATCCCATCAGCTGAGGGCCGGACCAAGGTCTTCTCCACCTGCCTA
CCACACCTATTTGTAGCCACCTTCTTTCTTTCAGCTGCAGGCTTTGAGTTTCTCAGACTG
CCTTCTGATTCCTCATCGACTGTGGACCTTGTATTCTCCGTATTCTATACTGTGATACCT
CCAACACTCAATCCAGTCATTTATAGCTTACGGAATGATTCCATGAAGGCAGCACTGAGG
AAGATGCTGTCAAAGGAAGAGCTTCCTCAGAGAAAAATGTGCTTAAAAGCCATGTTTAAA
CTC
Conceptual translation MVNLTSMSGFLLMGFSDERKLQILHALVFLVTYLLALTGNLLIITIITVDRRLHSPMYYF
LKHLSLLDLCFISVTVPQSIANSLMGNGYISLVQCILQVFFFIALASSEVAILTVMSYDR
YAAICQPLHYETIMDPRACRHAVIAVWIAGGLSGLMHAAINFSIPLCGKRVIHQFFCDVP
QMLKLACSYEFINEIALAAFTTSAAFICLISIVLSYIRIFSTVLRIPSAEGRTKVFSTCL
PHLFVATFFLSAAGFEFLRLPSDSSSTVDLVFSVFYTVIPPTLNPVIYSLRNDSMKAALR
KMLSKEELPQRKMCLKAMFKL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 100 -100 SNP T/C 1000GP (YRI, YRI)
6 29,274,486 29,274,486 NS C/T T/M rs9257694 (DbSNP)
6 29,275,228 29,275,228 SYN C/T G/G rs61735224 (DbSNP)
6 29,275,298 29,275,298 NS A/G M/V rs17404424 (DbSNP)
6 29,306,709 29,306,709 SNP T/C 1000GP (CEU, CHBJPT)
6 29,307,521 29,307,521 SNP G/A 1000GP (CEU)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M7T K184T V278M R291W % Freq CORP
1 M K V R 60.29 0.109
2 T K V R 38.25 0.109
3 T K M R 1.08 0.109
4 M K V W 0.23 0.109
5 M T V R 0.15 0.109

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5U1.aApr07-unspliced main_exon CDS chr6 29,306,690 29,307,652 +
3UTR chr6 29,307,652 29,307,655 +