Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR14K1 Olfactory Receptor

Gene Symbol OR14K11 (View this gene in GeneCards)
Family 14
Subfamily K
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases HsOR1.5.9
External Ids HGNC: 15025   
Build #39 labels OR5AY1
Chromosomal location 1:247,738,615-247,739,556 (+)
Cluster 1@248
Synteny CLIC#0
Remarks Belongs to OR14- a new family which is expanded in opossum and platypus. Was previously classified into family 5 with the symbol OR5AY1.

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR14A16 51.47% 307
OR14L1P 49.48% 287
OR14A2 51.16% 303

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR14J1B 51% 303
Chimp CONTIG658.51-15627 96% 236
Mouse Or14p1 51% 303
Rat Or14p1 51% 301
Cow OR14P2 51% 303

Expression evidences

Source Accession
GNF Atlas2 gnf1h10916_at

Sequence information

Nucleotide sequence ATGACCAATCAGACACAGATGATGGAATTCTTGCTTGTGAGATTTACTGAGAATTGGGTG
CTCCTGAGGCTGCATGCTTTGCTCTTCTCACTGATCTACCTCACGGCTGTGCTGATGAAT
TTAGTCATCATTCTCCTCATGATTCTGGACCATCGTCTCCACATGGCAATGTACTTTTTC
CTCCGACATTTGTCCTTCTTAGACCTGTGTCTCATTTCTGCCACAGTCCCCAAATCCATC
CTCAACTCTGTCGCCTCCACTGACTCCATCTCCTTCCTGGGGTGTGTGTTGCAGCTCTTC
TTGGTGGTACTGCTGGCTGGATCAGAGATTGGCATCCTTACTGCCATGTCCTATGACCGC
TATGCTGCCATCTGCTGCCCCCTACACTGTGAGGCTGTCATGAGCAGAGGGCTCTGTGTC
CAGTTGATGGCTCTGTCCTGGCTCAACAGAGGGGCCTTGGGACTCTTGTACACAGCTGGA
ACATTCTCTCTGAATTTTTATGGCTCTGATGAGCTACATCAGTTCTTCTGCGATGTCCCT
GCCCTACTAAAGCTCACTTGTTCTAAAGAACATGCCATCATTAGTGTCAGTGTGGCCATT
GGGGTCTGTTATGCATTTTCATGTTTAGTTTGCATTGTAGTTTCCTATGTGTACATTTTC
TCTGCTGTGTTAAGGATATCACAGAGACAGAGACAATCCAAAGCCTTTTCCAACTGTGTG
CCTCACCTCATTGTTGTCACTGTGTTTCTTGTAACAGGTGCTGTTGCTTATTTAAAGCCA
GGGTCTGATGCACCTTCTATTCTAGACTTGCTGGTGTCTGTGTTCTATTCTGTCGCACCT
CCAACCTTGAACCCTGTTATCTACTGTCTGAAGAACAAGGACATTAAATCCGCTCTGAGT
AAAGTCCTGTGGAATGTTAGAAGCAGTGGGGTAATGAAAAGA
Conceptual translation MTNQTQMMEFLLVRFTENWVLLRLHALLFSLIYLTAVLMNLVIILLMILDHRLHMAMYFF
LRHLSFLDLCLISATVPKSILNSVASTDSISFLGCVLQLFLVVLLAGSEIGILTAMSYDR
YAAICCPLHCEAVMSRGLCVQLMALSWLNRGALGLLYTAGTFSLNFYGSDELHQFFCDVP
ALLKLTCSKEHAIISVSVAIGVCYAFSCLVCIVVSYVYIFSAVLRISQRQRQSKAFSNCV
PHLIVVTVFLVTGAVAYLKPGSDAPSILDLLVSVFYSVAPPTLNPVIYCLKNKDIKSALS
KVLWNVRSSGVMKR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 247,901,983 247,901,983 SNP A/C rs41305743 (DbSNP)
1 247,902,448 247,902,448 SNP A/G rs61731398 (DbSNP)
1 247,902,677 247,902,677 SNP C/T rs61731394 (DbSNP)
1 247,902,693 247,902,693 SNP G/T rs61731393 (DbSNP)
1 247,902,408 247,902,408 SNP G/T rs61731395 (DbSNP)
1 247,738,681 247,738,681 SYN A/C R/R 1000GP (CEU)
1 247,738,636 247,738,636 NS A/G M/V 1000GP (CHBJPT)
1 100 -100 NS G/A R/H 1000GP (YRI, YRI, YRI)
1 100 -100 SYN G/T L/L 1000GP (YRI)

Variations - CNVs

Chr Start End Type Sources
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,849,473 248,277,638 CopyNumber Variation_48302 (DGV)
1 247,849,473 248,285,441 CopyNumber Variation_48303 (DGV)
1 247,901,817 247,904,858 CopyNumber #108 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

M8V R52C M134K D178N A254V K259N % Freq CORP
1 M R M D A K 94.85 1.000
2 M R M D A N 2.23 1.000
3 M R M N A K 1.23 1.000
4 M R M N V K 1.00 1.000
5 M C M D A K 0.31 1.000
6 V R M D A K 0.15 1.000
7 M R M D V K 0.15 1.000
8 M R K D A K 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR5AY1.aApr07-unspliced main_exon CDS chr1 247,738,615 247,739,556 +
3UTR chr1 247,739,556 247,739,559 +