Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR14L1P Olfactory Receptor

Gene Symbol OR14L1P1 (View this gene in GeneCards)
Family 14
Subfamily L
Pseudogene Yes
CORP pseudogene probability score
Aliases HsOR1.5.6
External Ids HGNC: 15023   
Build #39 labels OR5AV1
Chromosomal location 1:247,619,681-247,620,559 (+)
Cluster 1@248
Synteny CLIC#0
Remarks Coding for partial protein.

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR14A16 52.61% 287
OR14A2 53.63% 289
OR14J1 51.9% 289

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Chimp CONTIG*********** 99% 293
Cow OR14P2 54% 289

Expression evidences

Source Accession
GNF Atlas2 gnf1h03757_at

Sequence information

Nucleotide sequence ATGGGATTTTCGAATTCCTGGGATATTCAGATTGTACATGCTGCTCTATTCTTCCTAGTT
TACCTGGCAGCTGTCATAGGAAATCTCCTAATCATCATACTTACCACTCTGGATGTTCAC
CTCCAAACCCCAATGTATTTCTTTTTGAGAAACTTGTCTTTCTTAGATTTTTGTTACATC
TCTGTCACAATTCCAAAATCTATTGTTAGTTCCTTGACTCATGATACTTCCATTTCTTTC
TTTGGGTGTGCTCTGCAAGCCTTCTTTTTCATGGACTTGGCAACTACGGAGGTAGCCATC
CTTACAGTGATGTCCTATGACCGCTATATGGCCATCTGCCGGCCTTTACATTATGAGGTC
ATCATAAACCAAGGTGTCTGTCTGAGGATGATGGCCATGTCGTGGCTCAGTGGGGTGATC
TGTGGATTCATGCATGTGATAGCAACATTCTCATTACCATTCTGTGGGCGCAATAGAATA
CGTCAATTTTTCTGTAATATTCCACAGCTCCTAAGCCTCTTAGACCCCAAAGTAATTACC
ATTGAGATTGGAGTCATGGTTTTTGGTACAAGTCTTGTGATAATCTCCTTTGTTGTAATT
ACTCTCTCCTACATGTACATTTTTTCTGTCATCATGAGGATTCCTTCTAAGGAGGGTAGA
TCAAAAACATTTTCTACCTGCATTCCACATCTTGTGGTTGTAACACTCTTTATGATATCT
GGCAGCATTGCCTATGTGAAGCCAATTTCAAATTCTCCCCCCGTTCTGGATGTTTTCCTG
TCTGCGTTCTACACAGTCGTGCCCCCGACCCTGAACCCCGTCATCTATAGTCTGAGGAAT
AGGGACATGAAGGCAGCCCTGAGAAGGCAGTGTGGTCCC
Conceptual translation MGFSNSWDIQIVHAALFFLVYLAAVIGNLLIIILTTLDVHLQTPMYFFLRNLSFLDFCYI
SVTIPKSIVSSLTHDTSISFFGCALQAFFFMDLATTEVAILTVMSYDRYMAICRPLHYEV
IINQGVCLRMMAMSWLSGVICGFMHVIATFSLPFCGRNRIRQFFCNIPQLLSLLDPKVIT
IEIGVMVFGTSLVIISFVVITLSYMYIFSVIMRIPSKEGRSKTFSTCIPHLVVVTLFMIS
GSIAYVKPISNSPPVLDVFLSAFYTVVPPTLNPVIYSLRNRDMKAALRRQCGP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
1 100 -100 SNP C/G 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
1 247,620,003 247,620,003 SNP G/A 1000GP (CHBJPT)
1 247,620,187 247,620,187 SNP G/A 1000GP (CEU)
1 247,783,332 247,783,332 SNP A/G rs60516960 (DbSNP)
1 247,783,451 247,783,451 SNP C/T rs61706274 (DbSNP)
1 247,783,489 247,783,489 SNP A/G rs41268351 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
1 247,074,430 248,328,835 CopyNumber Variation_6816 (DGV)
1 247,714,585 248,277,146 CopyNumber Variation_3339 (DGV)
1 247,753,207 248,376,070 CopyNumber Variation_8353 (DGV)
1 247,753,334 248,322,316 CopyNumber Variation_2358 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.