Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1A1 Olfactory Receptor

Gene Symbol OR1A11 (View this gene in GeneCards)
Family 1
Subfamily A
Pseudogene No
CORP pseudogene probability score
Aliases OR17-7, OR17-11, HsOR17.1.7, ORL512, ORL741
External Ids HGNC: 8179   GeneBank: AF087918, AF399555, BC069169, BK004241, NM_014565   ORDB: ORL512, ORL741   
Build #39 labels OR1A1
Chromosomal location 17:3,215,621-3,216,547 (+)
Cluster 17@3b
Synteny CLIC#39
Remarks Segregating Pseudo Gene, a nonsynonymous SNP in a highly conserved amino-acid (rs2073153)

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1A2 83.5% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1A1 87% 308
Chimp CONTIG1419.8-20440 99% 309
Mouse Or1a1 84% 309
Mouse Or1a1b 84% 309
Rat Or1a1 82% 305
Rat Or1a1b 83% 304
Cow OR1A1 89% 309
Cow OR1A1D 86% 309
Cow OR1A1C 86% 309

Expression evidences

Source Accession
mRNA AB529296
GNF Atlas2 221388_at

Sequence information

Nucleotide sequence ATGAGGGAAAATAACCAGTCCTCTACACTGGAATTCATCCTCCTGGGAGTTACTGGTCAG
CAGGAACAGGAAGATTTCTTCTACATCCTCTTCTTGTTCATTTACCCCATCACATTGATT
GGAAACCTGCTCATCGTCCTAGCCATTTGCTCTGATGTTCGCCTTCACAACCCCATGTAT
TTTCTCCTTGCCAACCTCTCCTTGGTTGACATCTTCTTCTCATCGGTAACCATCCCTAAG
ATGCTGGCCAACCATCTCTTGGGCAGCAAATCCATCTCTTTTGGGGGATGCCTAACGCAG
ATGTATTTCATGATAGCCTTGGGTAACACAGACAGCTATATTTTGGCTGCAATGGCATAT
GATCGAGCTGTGGCCATCAGCCGCCCACTTCACTACACAACAATTATGAGTCCACGGTCT
TGTATCTGGCTTATTGCTGGGTCTTGGGTGATTGGAAATGCCAATGCCCTCCCCCACACT
CTGCTCACAGCTAGTCTGTCCTTCTGTGGCAACCAGGAAGTGGCCAACTTCTACTGTGAC
ATTACCCCCTTGCTGAAGTTATCCTGTTCTGACATCCACTTTCATGTGAAGATGATGTAC
CTAGGGGTTGGCATTTTCTCTGTGCCATTACTATGCATCATTGTCTCCTATATTCGAGTC
TTCTCCACAGTCTTCCAGGTTCCTTCCACCAAGGGCGTGCTCAAGGCCTTCTCCACCTGT
GGTTCCCACCTCACGGTTGTCTCTTTGTATTATGGTACAGTCATGGGCACGTATTTCCGC
CCTTTGACCAATTATAGCCTAAAAGACGCAGTGATCACTGTAATGTACACGGCAGTGACC
CCAATGTTAAATCCTTTCATCTACAGTCTGAGAAATCGGGACATGAAGGCTGCCCTGCGG
AAACTCTTCAACAAGAGAATCTCCTCG
Conceptual translation MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMY
FLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAY
DRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCD
ITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTC
GSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALR
KLFNKRISS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 3,119,648 3,119,648 NS A/C K/T rs62090945 (DbSNP)
17 3,119,297 3,119,297 NS A/G H/R rs4375699 (DbSNP)
17 3,119,611 3,119,611 NS A/G M/V rs17762735 (DbSNP)
17 3,119,744 3,119,744 NS C/T T/M rs61737301 (DbSNP)
17 3,119,767 3,119,767 NS C/T P/S rs769427 (DbSNP)
17 3,119,673 3,119,673 SYN A/G T/T rs769426 (DbSNP)
17 3,119,008 3,119,008 SYN C/T L/L rs4325604 (DbSNP)
17 3,119,049 3,119,049 SYN C/T I/I rs4374201 (DbSNP)
17 3,119,397 3,119,397 SYN G/T L/L rs769425 (DbSNP)
17 3,216,315 3,216,315 NS G/A G/D 1000GP (CEU)
17 3,216,003 3,216,003 NS G/A R/H 1000GP (CEU)
17 3,215,755 3,215,755 SYN C/T I/I 1000GP (CEU)
17 3,215,714 3,215,714 SYN T/C L/L 1000GP (CEU, CHBJPT)
17 3,216,103 3,216,103 SYN G/T L/L 1000GP (CEU)
17 3,216,317 3,216,317 NS G/A V/M 1000GP (CEU)
17 3,216,473 3,216,473 NS C/T P/S 1000GP (CEU, CHBJPT)
17 3,216,379 3,216,379 SYN A/G T/T 1000GP (CEU)
17 100 -100 SYN T/C L/L 1000GP (YRI, YRI, YRI, YRI, YRI)
17 100 -100 NS G/A R/H 1000GP (YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
17 3,018,447 3,159,865 CopyNumber Variation_2217 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R122* R128H V233M T277M M282V P285S % Freq CORP
1 R R V T M P 51.61 0.066
2 R R V T M S 34.18 0.715
3 R H V T M P 5.76 0.066
4 R R M T M P 5.30 0.066
5 R R M M M P 2.76 0.066
6 R R V T V P 0.23 0.066
7 * R V T M P 0.08 1.200
8 R H V T M S 0.08 0.715

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1A1.aApr07-unspliced main_exon CDS chr17 3,215,621 3,216,547 +
3UTR chr17 3,216,547 3,216,550 +