Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1A2 Olfactory Receptor

Gene Symbol OR1A21 (View this gene in GeneCards)
Family 1
Subfamily A
Pseudogene No
CORP pseudogene probability score 0.07 (functional)
Aliases OR17-6, OR17-10, HsOR17.1.6, ORL3339, ORL740
External Ids HGNC: 8180   GeneBank: AF155225, AF399556, BC069092, BK004242, NM_012352   ORDB: ORL3339, ORL740   
Build #39 labels OR1A2
Chromosomal location 17:3,197,519-3,198,445 (+)
Cluster 17@3b
Synteny CLIC#39
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1A1 83.5% 309

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1A1 79% 308
Chimp CONTIG1419.8-2291 98% 309
Mouse Or1a1b 78% 303
Rat Or1a1b 77% 303
Cow OR1A1D 82% 309
Cow OR1A1 81% 309

Expression evidences

Source Accession
ESTs CO247893
mRNA AB529297
GNF Atlas2 221445_at

Sequence information

Nucleotide sequence ATGAAGAAAGAAAATCAATCCTTTAACCTGGATTTTATTCTCCTGGGAGTTACTAGTCAG
CAAGAACAGAATAATGTCTTCTTTGTGATTTTTTTGTGCATTTACCCCATCACACTGACT
GGAAATCTGCTCATCATCTTGGCCATCTGTGCTGACATTCGCCTTCACAACCCCATGTAT
TTTCTCCTTGCCAACCTCTCCTTGGTTGACATCATCTTCTCATCCGTAACCATCCCTAAG
GTGCTGGCCAACCATCTCTTGGGGAGCAAGTTCATCTCCTTTGGGGGATGCCTAATGCAG
ATGTATTTCATGATAGCCTTGGCCAAGGCAGACAGCTATACCTTGGCTGCAATGGCATAC
GATCGAGCTGTGGCCATCAGCTGCCCACTTCATTACACAACAATTATGAGTCCACGGTCT
TGTATCCTGCTTATTGCTGGGTCTTGGGTGATTGGAAACACCAGTGCTCTCCCCCACACT
CTGCTCACAGCTAGTTTGTCCTTCTGTGGCAACCAGGAAGTAGCCAATTTCTACTGTGAC
ATTATGCCTTTGCTGAAGTTGTCCTGTTCTGACGTCCACTTTAATGTGAAGATGATGTAC
CTAGGGGTCGGCGTTTTCTCTTTGCCATTACTATGCATCATTGTCTCCTATGTTCAGGTC
TTTTCCACAGTCTTCCAAGTTCCATCTACCAAGAGTCTATTCAAAGCCTTCTGCACCTGT
GGCTCCCACCTCACAGTTGTTTTTTTATATTATGGTACAACGATGGGCATGTATTTCCGC
CCTCTGACCAGTTACAGCCCCAAAGATGCAGTGATAACTGTGATGTATGTGGCAGTGACC
CCAGCATTAAATCCTTTCATCTATAGTCTGAGAAATTGGGATATGAAGGCAGCCCTACAG
AAACTCTTCAGCAAGAGAATCTCCTCA
Conceptual translation MKKENQSFNLDFILLGVTSQQEQNNVFFVIFLCIYPITLTGNLLIILAICADIRLHNPMY
FLLANLSLVDIIFSSVTIPKVLANHLLGSKFISFGGCLMQMYFMIALAKADSYTLAAMAY
DRAVAISCPLHYTTIMSPRSCILLIAGSWVIGNTSALPHTLLTASLSFCGNQEVANFYCD
IMPLLKLSCSDVHFNVKMMYLGVGVFSLPLLCIIVSYVQVFSTVFQVPSTKSLFKAFCTC
GSHLTVVFLYYGTTMGMYFRPLTSYSPKDAVITVMYVAVTPALNPFIYSLRNWDMKAALQ
KLFSKRISS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 3,101,141 3,101,141 NS A/C E/A rs59497198 (DbSNP)
17 3,101,590 3,101,590 NS C/T R/C rs2469791 (DbSNP)
17 3,101,542 3,101,542 NS C/T L/F rs56058341 (DbSNP)
17 3,101,691 3,101,691 NS G/T W/C rs12150427 (DbSNP)
17 3,101,578 3,101,578 NS T/G C/G rs2241091 (DbSNP)
17 3,101,076 3,101,076 SYN C/G G/G rs2241092 (DbSNP)
17 3,101,172 3,101,172 SYN C/T Y/Y rs57842312 (DbSNP)
17 3,100,827 3,100,827 SYN T/C N/N rs2241093 (DbSNP)
17 3,198,284 3,198,284 NS G/T G/C 1000GP (CEU, CHBJPT)
17 3,198,296 3,198,296 NS C/T R/C 1000GP (CEU)
17 3,198,397 3,198,397 NS G/T W/C 1000GP (CEU, CHBJPT)
17 3,197,782 3,197,782 SYN G/C G/G 1000GP (CEU, CHBJPT)
17 3,197,533 3,197,533 SYN T/C N/N 1000GP (CEU, CHBJPT)
17 3,198,279 3,198,279 NS C/T T/M 1000GP (CHBJPT)
17 100 -100 SYN T/C N/N 1000GP (YRI, YRI, YRI)
17 100 -100 NS C/A A/E 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
17 3,018,447 3,159,865 CopyNumber Variation_2217 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A110E M118T T163I L244F T254M G256C R260C R260H I287F W293C % Freq CORP
1 A M T L T G R R I W 47.16 0.197
2 A M T L T C R R I C 30.57 0.197
3 A M T L T G C R I W 15.13 0.197
4 E M T F T G R R I W 2.84 0.197
5 A M T L M G R R I W 0.84 0.197
6 A M T L T G R R F C 0.77 0.197
7 A M T L T G R H I W 0.77 0.197
8 A M T L T C R R I W 0.38 0.197
9 A M T L T G C R I C 0.38 0.197
10 A M T L T G R R I C 0.31 0.197
11 A M T L T C C R I W 0.23 0.197
12 A M T L T C R H I C 0.15 0.197
13 A T T L T G R R I W 0.15 0.496
14 A M T L T C C R I C 0.08 0.197
15 A M T L T G C H I W 0.08 0.197
16 E M T F T G C R I W 0.08 0.197
17 A M I L T G R R I W 0.08 0.197

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1A2.aApr07-unspliced main_exon 5UTR chr17 3,197,509 3,197,519 +
CDS chr17 3,197,519 3,198,445 +
3UTR chr17 3,198,445 3,198,457 +