Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1D4 Olfactory Receptor

Gene Symbol OR1D41 (View this gene in GeneCards)
Family 1
Subfamily D
Pseudogene No
CORP pseudogene probability score
Aliases OR17-30, HsOR17.1.8P, ORL33, ORL1017
External Ids HGNC: 8185   ORDB: ORL33, ORL1017   
Build #39 labels OR1D4
Chromosomal location 17:3,240,676-3,241,611 (+)
Cluster 17@3b
Synteny CLIC#39
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1D5 98.4% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1D3P 81% 311
Chimp CONTIG1419.10-10399 97% 312
Chimp CONTIG3601.2-11308 95% 312
Mouse Or1d2 80% 310
Rat Or1d2 79% 310
Cow OR1D3B 80% 311
Cow OR1D3 81% 302

Expression evidences

Source Accession
mRNA BC122528

Sequence information

Nucleotide sequence ATGGATGGAGATAACCAGAGTGAGAACTCACAGTTCCTTCTCCTGGGGATCTCAGAGAGT
CCTGAGCAGCAGCAGATCCTGTTTTGGATGTTCCTGTCCATGTACCTGGTCACGGTGCTG
GGAAATGTGCTCATCATCCTGGCCATCAGCTCTGATTCCCACCTGCACACCCCCATGTAC
TTCTTCCTGGCCAACCTCTCCTTCACTGACCTCTTCTTTGTCACCAACACAATCCCCAAG
ATGCTGGTGAACTTCCAGTCCCAGAACAAAGCCATCTCCTATGCAGGGTGTCTGACACAG
CTCTACTTCCTGGTCTCCTTGGTGACCCTGGACAACCTCATCCTGGCCGTGATGGCGTAT
GATCGCTATGTGGCCATCTGCTGCCCCCTCCACTATGTCACAGCCATGAGCCCTGGGCTC
TGTGTCTTGCTCCTCTCCTTGTGTTGGGGGCTGTCTGTTCTCTATGGCCTCCTCCTCACC
TTCCTCCTGACCAGGGTGACCTTCTGTGGGCCTTGAGAGATCCACTACCTCTTCTGTGAC
ATGTACATCCTGCTGTGGCTGGCATGTTCCAACACCCACATCATTCACACAGTGTTGATT
GCCACTGGCTGCTTCATCTTCCTCACCCCCTTAGGGTTCATGACCACATCCTATGTACGT
ATTGTCAGAACCATCCTTCAAATGCCCTCAGCCTCTAAGAAATACAAAACCTTCTCTACC
TGTGCCTCCCATTTGGGTGTGGTCTCCCTCTTTTATGGGATGCTTGCTATGGTGTACCTG
CAGCCCCTCCATACCTACTCCATGAAGGACTCAGTAGCCACAGTGATGTATGCTGTGCTG
ACACCTATGATGAACCCTTTCATCTACAGGCTGAGGAACAAAGACATGCATGGGGCTCCG
GGAAGAGTCCTATGGAGACCCTTTCAGAGGCCTAAA
Conceptual translation MDGDNQSENSQFLLLGISESPEQQQILFWMFLSMYLVTVLGNVLIILAISSDSHLHTPMY
FFLANLSFTDLFFVTNTIPKMLVNFQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAY
DRYVAICCPLHYVTAMSPGLCVLLLSLCWGLSVLYGLLLTFLLTRVTFCGPXIHYLFCD
MYILLWLACSNTHIIHTVLIATGCFIFLTPLGFMTTSYVRIVRTILQMPSASKKYKTFST
CASHLGVVSLFYGMLAMVYLQPLHTYSMKDSVATVMYAVLTPMMNPFIYRLRNKDMHGAP
GRVLWRPFQRPK

Protein domains and features

Variations - CNVs

Chr Start End Type Sources
17 3,018,447 3,159,865 CopyNumber Variation_2217 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A242T % Freq CORP
1 A 99.16 1.200
2 T 0.84 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
LOC653166.aApr07-unspliced main_exon 5UTR chr17 3,240,622 3,240,676 +
CDS chr17 3,240,676 3,241,611 +
3UTR chr17 3,241,611 3,241,614 +