Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1D5 Olfactory Receptor

Gene Symbol OR1D51 (View this gene in GeneCards)
Family 1
Subfamily D
Pseudogene No
CORP pseudogene probability score
Aliases OR17-30, OR17-31, OR17-2, HsOR17.1.1, ORL511, ORL459
External Ids HGNC: 8186   GeneBank: AF087923, AF399533, AF399534, BK004245, HSU04681, NM_014566   ORDB: ORL511, ORL459   
Build #39 labels
Chromosomal location 17:3,062,672-3,063,607 (-)
Cluster 17@3b
Synteny CLIC#39
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1D4 98.4% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1D3P 82% 311
Chimp CONTIG1419.10-10399 97% 312
Chimp CONTIG3601.2-11308 94% 312
Mouse Or1d2 81% 310
Rat Or1d2 80% 310
Cow OR1D3B 79% 311
Cow OR1D3 81% 302

Expression evidences

Source Accession
mRNA AB529301

Sequence information

Nucleotide sequence ATGGATGGAGATAACCAGAGTGAGAACTCACAGTTCCTTCTCCTGGGGATCTCAGAGAGT
CCTGAGCAGCAGCGGATCCTGTTTTGGATGTTCCTGTCCATGTACCTGGTCACGGTGCTG
GGAAATGTGCTCATCATCCTGGCCATCAGCTCTGATTCCCACCTGCACACCCCCATGTAC
TTCTTCCTGGCCAACCTCTCCTTCACTGACCTCTTCTTTGTCACCAACACAATCCCCAAG
ATGCTGGTGAACTTCCAGTCCCAGAACAAAGCCATCTCCTATGCAGGGTGTCTGACACAG
CTCTACTTCCTGGTCTCCTTGGTGACCCTGGACAACCTCATCCTGGCCGTGATGGCGTAT
GATCGCTATGTGGCCACCTGCTGCCCCCTCCACTATGTCACAGCCATGAGCCCTGGGCTC
TGTGTCTTGCTCCTCTCCTTGTGTTGGGGGCTGTCTGTTCTCTATGGCCTCCTCCTCACC
TTCCTCCTGACCAGGGTGACCTTCTGTGGGCCTCGAGAGATCCACTACCTCTTCTGTGAC
ATGTACATCCTGCTGTGGCTGGCATGTTCCAACACCCACATCATTCACACAGCGTTGATT
GCCACTGGCTGCTTCATCTTCCTCACCCCCTTAGGGTTCATGACCACATCCTATGTACGT
ATTGTCAGAACCATCCTTCAAATGCCCTCGGCCTCTAAGAAATACAAAACCTTCTCTACC
TGTGCCTCCCATTTGGGTGTGGTCTCCCTCTTTTATGGGACGCTTGCTATGGTGTACCTG
CAGCCCCTCCATACCTACTCCATGAAGGACTCAGTAGCCACAGTGATGTATGCTGTGCTG
ACACCTATGATGAACCCTTTCATCTACAGGCTGAGGAACAAAGACATGCATGGGGCTCCG
GGAAGAGTCCTATGGAGACCCTTTCAGAGGCCTAAA
Conceptual translation MDGDNQSENSQFLLLGISESPEQQRILFWMFLSMYLVTVLGNVLIILAISSDSHLHTPMY
FFLANLSFTDLFFVTNTIPKMLVNFQSQNKAISYAGCLTQLYFLVSLVTLDNLILAVMAY
DRYVATCCPLHYVTAMSPGLCVLLLSLCWGLSVLYGLLLTFLLTRVTFCGPREIHYLFCD
MYILLWLACSNTHIIHTALIATGCFIFLTPLGFMTTSYVRIVRTILQMPSASKKYKTFST
CASHLGVVSLFYGTLAMVYLQPLHTYSMKDSVATVMYAVLTPMMNPFIYRLRNKDMHGAP
GRVLWRPFQRPK

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 2,966,273 2,966,273 NS A/G L/P rs2676567 (DbSNP)
17 2,966,173 2,966,173 SYN C/G S/S rs61752193 (DbSNP)
17 2,966,191 2,966,191 SYN G/A T/T rs61752194 (DbSNP)
17 2,966,308 2,966,308 SYN T/C A/A rs2855605 (DbSNP)
17 3,063,014 3,063,014 SYN C/T A/A 1000GP (CEU)
17 100 -100 SYN C/T A/A 1000GP (YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1D4.aApr07-unspliced main_exon 3UTR chr17 3,062,669 3,062,672 -
CDS chr17 3,062,672 3,063,607 -
5UTR chr17 3,063,607 3,063,661 -