Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1E1 Olfactory Receptor

Gene Symbol OR1E11 (View this gene in GeneCards)
Family 1
Subfamily E
Pseudogene No
CORP pseudogene probability score
Aliases OR17-2, OR17-2, OR17-32, OR17-32, OR17-18, HSA12, OR17-4, HGMP07I, OR13-66, OR5-85, HsOR17.1.14, ORL255, ORL20
External Ids HGNC: 8189   GeneBank: AF087916, AF179761, AF399550, BK004237, BK004353, HSHGM071, HSU04642, HSU04682, NM_003553, U86222, U86274   ORDB: ORL255, ORL20   
Build #39 labels OR1E1, OR1E9P, OR1E5, OR1E6
Chromosomal location 17:3,397,469-3,398,410 (-)
Cluster 17@3b
Synteny CLIC#39
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1E2 92.26% 323

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1E1 84% 314
Dog OR1E1F 81% 303
Chimp CONTIG1419.27-1053 96% 314
Chimp CONTIG1878.1-733 95% 314
Mouse Or1e1 84% 314
Mouse Or1e1c 84% 311
Mouse Or1e1b-ps 81% 312
Rat Or1e1 84% 314
Rat Or1e1c 82% 311
Rat Or1e16c 81% 309
Cow OR1E1 83% 314
Cow OR1E1H 83% 314
Cow OR1E1G 83% 314
Cow OR1E1I 82% 314
Cow OR1E38 81% 314
Cow OR1E2 82% 314
Cow OR1E2B 82% 314
Cow OR1E1F 80% 306

Expression evidences

Source Accession
ESTs CO247872
mRNA BC166630
GNF Atlas2 214515_at

Sequence information

Nucleotide sequence ATGATGGGACAAAATCAAACCAGCATCTCAGACTTCCTGCTCCTGGGCCTGCCCATCCAA
CCAGAGCAGCAAAACCTGTGCTATGCCCTGTTCTTGGCCATGTATCTTACCACCCTCCTG
GGGAACCTCCTCATCATTGTCCTCATTCGACTGGACTCCCATCTCCACACGCCTATGTAT
TTGTTTCTCAGCAACTTGTCCTTCTCTGACCTCTGCTTCTCTTCCGTGACCATTCCCAAG
TTGTTACAGAACATGCAGAACCAGGACCCATCCATCCCCTATGCGGACTGCCTGACCCAA
ATGTACTTCTTCCTGTTATTTGGAGACCTGGAGAGCTTCCTCCTTGTGGCCATGGCCTAT
GACCGCTATGTGGCCATCTGCTTCCCCCTGCACTACACCGCCATCATGAGCCCCATGCTC
TGTCTCGCCCTGGTGGCGCTGTCCTGGGTGCTGACCACCTTCCATGCCATGTTACACACT
TTACTCATGGCCAGGTTGTGTTTTTGTGCAGACAATGTGATCCCCCACTTTTTCTGTGAT
ATGTCTGCTCTGCTGAAGCTGGCCTTCTCTGACACTCGAGTTAATGAATGGGTGATATTT
ATCATGGGAGGGCTCATTCTTGTCATCCCATTCCTACTCATCCTTGGGTCCTATGCAAGA
ATTGTCTCCTCCATCCTCAAGGTCCCTTCTTCTAAGGGTATCTGCAAGGCCTTCTCTACT
TGTGGCTCCCACCTGTCTGTGGTGTCACTGTTCTATGGAACCGTTATTGGTCTCTACTTA
TGCTCATCAGCTAATAGTTCTACTCTAAAGGACACTGTCATGGCTATGATGTACACTGTG
GTGACCCCCATGCTGAACCCCTTCATCTACAGCCTGAGGAACAGAGACATGAAGGGAGCC
CTGAGCAGAGTCATTCATCAGAAGAAAACTTTCTTCTCTCTC
Conceptual translation MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY
LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAY
DRYVAICFPLHYTAIMSPMLCLALVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD
MSALLKLAFSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKAFST
CGSHLSVVSLFYGTVIGLYLCSSANSSTLKDTVMAMMYTVVTPMLNPFIYSLRNRDMKGA
LSRVIHQKKTFFSL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 3,301,626 3,301,626 NS A/G C/R rs62091316 (DbSNP)
17 3,301,319 3,301,319 NS A/G L/P rs1735011 (DbSNP)
17 3,301,275 3,301,275 NS C/G V/L rs1735010 (DbSNP)
17 3,301,278 3,301,278 NS C/T A/T rs150989 (DbSNP)
17 3,300,921 3,300,921 NS G/A P/S rs379856 (DbSNP)
17 3,301,549 3,301,549 SYN A/G D/D rs150988 (DbSNP)
17 3,301,246 3,301,246 SYN A/G T/T rs11078447 (DbSNP)
17 3,300,943 3,300,943 SYN A/G T/T rs58631068 (DbSNP)
17 3,300,934 3,300,934 SYN A/T G/G rs769422 (DbSNP)
17 3,300,970 3,300,970 SYN C/G L/L rs61735439 (DbSNP)
17 3,301,480 3,301,480 SYN G/A S/S rs61735437 (DbSNP)
17 3,301,363 3,301,363 SYN G/T L/L rs11078448 (DbSNP)
17 3,300,946 3,300,946 SYN T/C G/G rs404983 (DbSNP)
17 3,301,534 3,301,534 SYN T/C T/T rs61735436 (DbSNP)
17 3,397,640 3,397,640 SYN A/T G/G 1000GP (CEU, CHBJPT)
17 100 -100 SYN A/T G/G 1000GP (YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 42 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V280L A143T A95V % Freq CORP
1 V A A 98.62 0.068
2 V T A 0.92 0.068
3 V A V 0.31 0.068
4 L A A 0.15 0.068

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1E1.aApr07-unspliced main_exon 3UTR chr17 3,397,104 3,397,469 -
CDS chr17 3,397,469 3,398,410 -