Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1E2 Olfactory Receptor

Gene Symbol OR1E21 (View this gene in GeneCards)
Family 1
Subfamily E
Pseudogene No
CORP pseudogene probability score 0.14 (functional)
Aliases OR17-136, OR17-135, OR17-135, OR17-93, OR17-93, OR17-17, OR17-19, OR17-3, HsOR17.1.16, ORL264, ORL738
External Ids HGNC: 8190   GeneBank: AF087925, AF399551, BK004235, BK004352, BK004585, HSU04686, NM_003554, U86241, U86242   ORDB: ORL264, ORL738   
Build #39 labels OR1E2
Chromosomal location 17:3,432,873-3,433,841 (-)
Cluster 17@3b
Synteny CLIC#39
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1E1 92.26% 323

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1E1 82% 321
Mouse Or1e1c 83% 315
Mouse Or1e1 82% 318
Rat Or1e1 82% 318
Rat Or1e1c 81% 315
Cow OR1E1 80% 323
Cow OR1E1H 80% 321
Orang OR1E2P 81% 365
Horse OR1E1 82% 318
Horse OR1E1L 81% 318
Chimp OR1E1 93% 321

Expression evidences

Source Accession
ESTs CO249498
mRNA AB529302
GNF Atlas2 208587_s_at

Sequence information

Nucleotide sequence ATGATGGGACAAAATCAAACCAGCATCTCAGACTTCCTGCTCCTGGGCCTGCCCATCCAA
CCAGAGCAGCAAAACCTGTGCTATGCCCTGTTCTTGGCCATGTATCTTACCACCCTCCTG
GGGAACCTCCTCATCATTGTCCTCATTCGACTGGACTCCCATCTCCACACGCCTGTGTAT
TTGTTTCTCAGCAACTTGTCCTTCTCTGACCTCTGCTTTTCCTCAGTCACAATGCCCAAA
TTGCTGCAGAACATGCAGAACCAAGACCCATCCATCCCCTATGCAGACTGCCTGACCCAA
ATGTACTTCTTCTTGTATTTTTCGGATCTAGAGAGCTTCCTCCTTGTGGCCATGGCCTAT
GACCGCTATGTGGCCATCTGCTTCCCCATGCACTACACCGCCATCTGCTTCCTCCTGCAC
TACACCGCCATCATGAGCCCCATGCTCTGTCTCTCCGTGGTGGCGCTGTCCTGGGTGCTG
ACCACCTTCCATGCCATGTTACACACTTTACTCATGGCCAGGTTGTGTTTTTGTGCAGAC
AATGTGATCCCCCACTTTTTCTGTGATATGTCTGCTCTGCTGAAGCTGGCCTGCTCTGAC
ACTCGAGTTAATGAATGGGTGATATTTATCATGGGAGGGCTCATTCTTGTCATCCCATTC
CTACTCATCCTTGGGTCCTATGCAAGAATTGTCTCCTCCATCCTCAAGGTCCCTTCTTCT
AAGGGTATCTGCAAGGCCTTCTCTACTTGTGGCTCCCACCTCTCTGTGGTGTCACTGTTC
TATGGGACCGTTATTGGTCTCTACTTATGCCCATCAGCTAATAGTTCTACTCTAAAGGAC
ACTGTCATGGCTATGATGTACACTGTGGTGACCCCTATGCTGACCCCCTTCATCTACAGC
CTGAGGAACAGAGACATGAAGGGAGCCCTGGAAAGGGTCATTTGTAAAAGGAAAAATCCC
TTCCTTCTA
Conceptual translation MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPVY
LFLSNLSFSDLCFSSVTMPKLLQNMQNQDPSIPYADCLTQMYFFLYFSDLESFLLVAMAY
DRYVAICFPMHYTAICFLLHYTAIMSPMLCLSVVALSWVLTTFHAMLHTLLMARLCFCAD
NVIPHFFCDMSALLKLACSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSS
KGICKAFSTCGSHLSVVSLFYGTVIGLYLCPSANSSTLKDTVMAMMYTVVTPMLTPFIYS
LRNRDMKGALERVICKRKNPFLL

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 3,336,799 3,336,798 Ins(1) -/T rs34073940 (DbSNP)
17 3,336,899 3,336,898 Ins(1) -/T rs34838055 (DbSNP)
17 3,336,723 3,336,723 NS A/G L/P rs73296096 (DbSNP)
17 3,337,057 3,337,057 NS G/A R/C rs769431 (DbSNP)
17 3,336,374 3,336,374 SYN C/G L/L rs436972 (DbSNP)
17 3,336,260 3,336,260 SYN G/A P/P rs61739591 (DbSNP)
17 3,336,845 3,336,845 SYN G/A C/C rs2640077 (DbSNP)
17 100 -100 NS A/C S/A 1000GP (YRI, YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 139 (Hasin)
17 3,334,167 3,337,235 Deletion #243 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

V153L S152A M145V D109Y % Freq CORP
1 V S M D 97.47 1.000
2 L A M D 1.61 1.000
3 V S M Y 0.61 1.000
4 V S V D 0.31 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1E2.aApr07-unspliced main_exon 3UTR chr17 3,432,866 3,432,873 -
CDS chr17 3,432,873 3,433,841 -
5UTR chr17 3,433,841 3,433,848 -