Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1F12 Olfactory Receptor

Gene Symbol OR1F121 (View this gene in GeneCards)
Family 1
Subfamily F
Pseudogene No
CORP pseudogene probability score 0.04 (functional)
Aliases OR6-12, dJ313I6.5, hs6M1-35P, HsOR6.2.8, ORL3139
External Ids HGNC: 13964   GeneBank: AB065468, BK004273, NG_004691, XM_498061   ORDB: ORL3139   
Build #39 labels OR1F12
Chromosomal location 6:28,073,316-28,074,236 (+)
Cluster 6@28a
Synteny CLIC#12
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1F1 61.24% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1F41P 79% 277
Chimp CONTIG904.61-2336 62% 307
Chimp CONTIG2961.4-6349 57% 305
Chimp CONTIG1419.27-1053 55% 307
Mouse Or1f12 86% 307
Rat Or1f12-ps 82% 307
Cow OR1F12 83% 307

Sequence information

Nucleotide sequence ATGGAAGGGAAAAATCAAACCAATATCTCTGAATTTCTCCTCCTGGGCTTCTCAAGTTGG
CAACAACAGCAGGTGCTACTCTTTGCACTTTTCCTGTGTCTCTATTTAACAGGGCTGTTT
GGAAACTTACTCATCTTGCTGGCCATTGGCTCGGATCACTGCCTTCACACACCCATGTAT
TTCTTCCTTGCCAATCTGTCCTTGGTAGACCTCTGCCTTCCCTCAGCCACAGTCCCCAAG
ATGCTACTGAACATCCAAACCCAAACCCAAACCATCTCCTATCCCGGCTGCCTGGCTCAG
ATGTATTTCTGTATGATGTTTGCCAATATGGACAATTTTCTTCTCACAGTGATGGCATAT
GACCGTTACGTGGCCATCTGTCACCCTTTACATTACTCCACCATTATGGCCCTGCGCCTC
TGTGCCTCTCTGGTAGCTGCACCTTGGGTCATTGCCATTTTGAACCCTCTCTTGCACACT
CTTATGATGGCCCATCTGCACTTCTGCTCTGATAATGTTATCCACCATTTCTTCTGTGAT
ATCAACTCTCTCCTCCCTCTGTCCTGTTCCGACACCAGTCTTAATCAGTTGAGTGTTCTG
GCTACGGTGGGGCTGATCTTTGTGGTACCTTCAGTGTGTATCCTGGTATCCTATATCCTC
ATTGTTTCTGCTGTGATGAAAGTCCCTTCTGCCCAAGGAAAACTCAAGGCTTTCTCTACC
TGTGGATCTCACCTTGCCTTGGTCATTCTTTTCTATGGAGCAATCACAGGGGTCTATATG
AGCCCCTTATCCAATCACTCTACTGAAAAAGACTCAGCCGCATCAGTCATTTTTATGGTT
GTAGCACCTGTGTTGAATCCATTCATTTACAGTTTAAGAAACAATGAACTGAAGGGGACT
TTAAAAAAGACCCTAAGCCGA
Conceptual translation MEGKNQTNISEFLLLGFSSWQQQQVLLFALFLCLYLTGLFGNLLILLAIGSDHCLHTPMY
FFLANLSLVDLCLPSATVPKMLLNIQTQTQTISYPGCLAQMYFCMMFANMDNFLLTVMAY
DRYVAICHPLHYSTIMALRLCASLVAAPWVIAILNPLLHTLMMAHLHFCSDNVIHHFFCD
INSLLPLSCSDTSLNQLSVLATVGLIFVVPSVCILVSYILIVSAVMKVPSAQGKLKAFST
CGSHLALVILFYGAITGVYMSPLSNHSTEKDSAASVIFMVVAPVLNPFIYSLRNNELKGT
LKKTLSR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
6 28,041,996 28,041,996 Del(1) -/A rs34495429 (DbSNP)
6 28,041,669 28,041,668 Ins(2) -/CC rs67996847 (DbSNP)
6 28,041,670 28,041,669 Ins(2) -/CC rs61630977 (DbSNP)
6 28,041,671 28,041,670 Ins(2) -/CC rs72340643 (DbSNP)
6 28,041,668 28,041,667 Ins(2) -/CC rs35106887 (DbSNP)
6 28,041,977 28,041,977 NS A/G N/S rs73396550 (DbSNP)
6 28,041,857 28,041,857 NS A/T N/I rs203870 (DbSNP)
6 28,042,014 28,042,014 SYN A/G R/R rs203871 (DbSNP)
6 28,041,906 28,041,906 SYN C/T D/D rs9380048 (DbSNP)
6 28,074,079 28,074,079 NS T/A I/N 1000GP (CEU, CHBJPT)
6 28,074,199 28,074,199 NS A/G N/S 1000GP (CEU, CHBJPT)
6 100 -100 SYN G/A Q/Q 1000GP (YRI)
6 100 -100 NS T/A I/N 1000GP (YRI, YRI)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

G96S I255N N295S % Freq CORP
1 G I N 66.51 0.098
2 G I S 24.35 0.098
3 G N N 9.06 0.098
4 S I N 0.08 0.098