Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1G1 Olfactory Receptor

Gene Symbol OR1G11 (View this gene in GeneCards)
Family 1
Subfamily G
Pseudogene No
CORP pseudogene probability score 0.36 (functional)
Aliases OR17-209, OR17-209, OR17-130, OR17-130, OR17-8, HsOR17.1.4, ORL3747
External Ids HGNC: 8204   GeneBank: AF087928, BC069379, BK004243, HSU04689, NM_003555, U86240   ORDB: ORL3747   
Build #39 labels OR1G1
Chromosomal location 17:3,126,613-3,127,551 (-)
Cluster 17@3b
Synteny CLIC#39
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1F1 56.72% 305
OR7A10 58.94% 302
OR7A5 59.28% 307

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1F15 59% 310
Chimp CONTIG2961.4-6349 96% 313
Mouse Or7a36 56% 308
Rat Or1ad8 56% 305
Cow OR1G4 79% 312

Expression evidences

Source Accession
ESTs DN693331
mRNA AB529303
GNF Atlas2 221375_at

Sequence information

Nucleotide sequence ATGGAGGGGAAAAATCTGACCAGCATCTCAGAATGTTTCCTCCTGGGGTTCTCTGAGCAG
CTGGAGGAGCAGAAGCCCCTCTTTGGGTCCTTCCTGTTCATGTACTTGGTCACGGTGGCA
GGCAACCTCCTCATCATTCTAGTCATCATTACTGACACTCAACTCCATACCCCCATGTAC
TTCTTTCTAGCCAACCTCTCCCTTGCAGATGCCTGCTTTGTGTCCACCACAGTCCCTAAG
ATGCTGGCAAACATACAGATCCAGAGTCAGGCCATCTCCTACTCAGGGTGTCTACTACAG
TTGTATTTTTTCATGTTATTTGTGATGCTGGAGGCATTCCTCTTGGCGGTCATGGCCTAT
GACTGCTACGTGGCCATATGCCACCCACTTCATTACATTCTGATCATGAGCCCTGGGCTC
TGCATCTTCCTCGTGTCTGCATCCTGGATCATGAATGCCCTCCACTCCCTTCTACACACA
CTTCTGATGAACAGCCTGTCCTTCTGCGCAAACCATGAGATCCCACACTTCTTCTGTGAC
ATCAATCCCCTCCTGAGTCTGTCCTGCACAGACCCCTTCACCAATGAGCTGGTGATCTTC
ATCACTGGGGGTCTCACAGGACTCATTTGTGTGCTTTGCCTGATTATCTCTTACACGAAC
GTTTTCTCGACCATCCTGAAGATCCCATCAGCTCAGGGGAAGCGGAAAGCCTTTTCCACC
TGCAGCTCTCATCTCTCCGTGGTCTCTCTCTTCTTTGGGACTTCTTTTTGTGTTGATTTC
AGTTCTCCCTCAACCCACTCGGCCCAGAAGGACACAGTTGCATCAGTGATGTACACAGTG
GTAACTCCAATGTTGAATCCCTTTATCTACAGTTTGAGGAACCAAGAAATAAAGTCTTCC
CTGAGAAAGTTAATCTGGGTTCGGAAAATTCATTCCCCT
Conceptual translation MEGKNLTSISECFLLGFSEQLEEQKPLFGSFLFMYLVTVAGNLLIILVIITDTQLHTPMY
FFLANLSLADACFVSTTVPKMLANIQIQSQAISYSGCLLQLYFFMLFVMLEAFLLAVMAY
DCYVAICHPLHYILIMSPGLCIFLVSASWIMNALHSLLHTLLMNSLSFCANHEIPHFFCD
INPLLSLSCTDPFTNELVIFITGGLTGLICVLCLIISYTNVFSTILKIPSAQGKRKAFST
CSSHLSVVSLFFGTSFCVDFSSPSTHSAQKDTVASVMYTVVTPMLNPFIYSLRNQEIKSS
LRKLIWVRKIHSP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
17 3,030,482 3,030,481 Ins(1) -/C rs34207115 (DbSNP)
17 3,030,582 3,030,582 NS C/G Q/H rs9892491 (DbSNP)
17 3,030,130 3,030,130 NS G/A S/F rs61736117 (DbSNP)
17 3,030,676 3,030,676 NS G/A T/I rs61736114 (DbSNP)
17 3,030,477 3,030,477 SYN G/A Y/Y rs61736115 (DbSNP)
17 3,030,291 3,030,291 SYN T/C L/L rs61736116 (DbSNP)
17 3,127,382 3,127,382 NS G/A T/I 1000GP (CHBJPT)
17 100 -100 NS G/A S/F 1000GP (YRI, YRI)
17 100 -100 SYN C/T L/L 1000GP (YRI, YRI, YRI)

Variations - CNVs

Chr Start End Type Sources
17 3,018,447 3,159,865 CopyNumber Variation_2217 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

S239F V145M Q88H T57I % Freq CORP
1 S V Q T 84.38 0.602
2 S V H T 13.04 0.602
3 F V Q T 1.49 0.703
4 S V Q I 0.82 0.602
5 S M Q T 0.27 0.602

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1G1.aApr07-unspliced main_exon 3UTR chr17 3,126,584 3,126,613 -
CDS chr17 3,126,613 3,127,551 -
5UTR chr17 3,127,551 3,127,582 -