Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1I1 Olfactory Receptor

Gene Symbol OR1I11 (View this gene in GeneCards)
Family 1
Subfamily I
Pseudogene No
CORP pseudogene probability score 0 (functional)
Aliases OR19-20, F20569, HsOR19.3.12, ORL314
External Ids HGNC: 8207   GeneBank: AF399548, NM_001004713   ORDB: ORL314   
Build #39 labels OR1I1
Chromosomal location 19:15,087,066-15,088,010 (+)
Cluster 19@15b
Synteny CLIC#45
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1F1 56.49% 308
OR1N1 56.81% 301
OR1N2 56.19% 299

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1I1 81% 310
Chimp CONTIG17737.1-893 94% 315
Mouse Or1i2 77% 307
Rat Or1i2 76% 307
Cow OR1I1 78% 309

Expression evidences

Source Accession
mRNA AB529304

Sequence information

Nucleotide sequence ATGGAACCAGAAAAGCAAACCGAAATCTCAGAATTCTTCCTCCAGGGACTCTCAGAAAAG
CCAGAGCATCAGACCCTCCTCTTCACAATGTTCCTCTCCACATACCTGGTCACCATCATT
GGAAATGCCCTCATTATCCTGGCCATCATCACGGACTCTCACCTCCACACACCCATGTAC
TTCTTTCTCTTCAACCTCTCACTCGTTGACACCCTATTATCCTCCACCACCGTCCCCAAG
ATGCTAGCGAACATCCAGGCTCAGAGCAGAGCCATCCCCTTTGTGGGCTGCCTCACCCAG
ATGTATGCCTTCCACCTGTTCGGGACCATGGACAGCTTTCTCCTGGCAGTAATGGCCATC
GACCGCTTCGTGGCCATTGTCCACCCACAGCGTTACTTGGTTCTCATGTGCTCCCCTGTC
TGTGGGCTGCTGCTGGGAGCATCATGGATGATCACCAACCTCCAGTCTCTCATACACACC
TGCCTCATGGCTCAACTGACCTTCTGCGCCGGCTCTGAAATCTCCCACTTCTTCTGTGAC
CTCATGCCCCTGCTGAAGCTCTCCGGCTCAGACACGCACACCAACGAGCTGGTGATCTTT
GCTTTTGGCATTGTCGTGGGCACCAGCCCATTCTCCTGCATCCTTCTCTCGTACATCCGC
ATTTTCTGGACAGTCTTTAAGATCCCTTCTACTCGGGGCAAGTGGAAAGCCTTCTCCACC
TGTGGCTTACACCTCACTGTGGTGTCACTGTCCTATGGGACCATCTTTGCTGTGTACTTA
CAGCCCACATCCCCCAGCTCCTCCCAGAAGGACAAGGCAGCCGCCCTAATGTGTGGGGTG
TTCATCCCCATGCTCAACCCCTTTATCTACAGCATACGGAACAAGGATATGAAGGCAGCC
CTGGGGAAGCTCATCGGCAAAGTGGCCGTCCCCTGTCCTAGGCCA
Conceptual translation MEPEKQTEISEFFLQGLSEKPEHQTLLFTMFLSTYLVTIIGNALIILAIITDSHLHTPMY
FFLFNLSLVDTLLSSTTVPKMLANIQAQSRAIPFVGCLTQMYAFHLFGTMDSFLLAVMAI
DRFVAIVHPQRYLVLMCSPVCGLLLGASWMITNLQSLIHTCLMAQLTFCAGSEISHFFCD
LMPLLKLSGSDTHTNELVIFAFGIVVGTSPFSCILLSYIRIFWTVFKIPSTRGKWKAFST
CGLHLTVVSLSYGTIFAVYLQPTSPSSSQKDKAAALMCGVFIPMLNPFIYSIRNKDMKAA
LGKLIGKVAVPCPRP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
19 100 -100 NS G/A E/K 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI, YRI)
19 100 -100 SYN A/G P/P 1000GP (YRI, YRI, YRI)
19 15,087,213 15,087,213 NS A/T I/F 1000GP (CEU, CHBJPT)
19 15,087,389 15,087,389 SYN G/A G/G 1000GP (CHBJPT)
19 15,087,452 15,087,452 SYN A/G P/P 1000GP (CEU, CHBJPT)
19 15,087,481 15,087,481 NS C/G P/R 1000GP (CEU, CHBJPT)
19 15,087,552 15,087,552 NS A/C M/L 1000GP (CEU, CHBJPT)
19 15,087,630 15,087,630 NS G/T G/C 1000GP (CEU, CHBJPT)
19 15,087,696 15,087,696 NS T/C F/L 1000GP (CEU, CHBJPT)
19 15,087,795 15,087,795 NS C/T H/Y 1000GP (CEU, CHBJPT)
19 15,087,813 15,087,813 SYN C/T L/L 1000GP (CEU, CHBJPT)
19 15,087,820 15,087,820 NS A/C Y/S 1000GP (CEU, CHBJPT)
19 15,087,909 15,087,909 NS A/T I/F 1000GP (CEU, CHBJPT)
19 15,087,940 15,087,940 NS T/C I/T 1000GP (CEU, CHBJPT)
19 15,087,953 15,087,953 SYN T/C D/D 1000GP (CEU, CHBJPT)
19 15,197,898 15,197,898 NS A/G K/E rs73522019 (DbSNP)
19 15,198,024 15,198,024 NS A/T I/F rs59166286 (DbSNP)
19 15,198,263 15,198,263 SYN A/G P/P rs8105277 (DbSNP)
19 15,198,292 15,198,292 NS C/G P/R rs8104843 (DbSNP)
19 15,198,322 15,198,321 Ins(1) -/G rs35240562 (DbSNP)
19 15,198,441 15,198,441 NS G/T G/C rs73008811 (DbSNP)
19 15,198,507 15,198,507 NS C/T L/F rs8108721 (DbSNP)
19 15,198,551 15,198,551 SYN C/T V/V rs16980310 (DbSNP)
19 15,198,606 15,198,606 NS C/T H/Y rs73008812 (DbSNP)
19 15,198,631 15,198,631 NS A/C Y/S rs8105737 (DbSNP)
19 15,198,751 15,198,751 NS C/T T/I rs16980312 (DbSNP)
19 15,198,764 15,198,764 SYN C/T D/D rs12975625 (DbSNP)
19 15,198,780 15,198,780 NS A/G R/G rs35396476 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
19 15,096,950 15,259,179 CopyNumber Variation_4068 (DGV)
19 15,197,777 15,200,821 CopyNumber #131 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

E8K L14F A43D I50F R122H P139R M163L G189C F211L R220H H244Y Y252S S264T I282F I292T % Freq CORP
1 E L A I R R M G L R H S S I I 48.16 0.001
2 E L A I R P M G F R H Y S I I 27.88 0.002
3 E L A F R R M C L R Y Y S I T 15.05 0.026
4 E L A I R P L G F R H Y S F I 3.46 0.002
5 K L A I H P M G F R H Y S I I 2.38 0.034
6 E L A I R R M G L H H S S I I 1.15 0.001
7 E L A I R R M G L R H S T I I 0.77 0.001
8 E L A I R P M G L R H Y S I I 0.31 0.002
9 E L A F R R M C L R Y Y S I I 0.15 0.026
10 E L D I R R M G L R H S S I I 0.15 0.001
11 E L A I R R M G F R H S S I I 0.15 0.001
12 E L A I R P M G L R H S S I I 0.08 0.001
13 E L A I R P L G F R H Y S F T 0.08 0.002
14 E L A I R R M G L R Y Y S I I 0.08 0.027
15 E F A I R R M G L R H S S I I 0.08 0.001
16 E L A F R P M C L R Y Y S I T 0.08 0.026

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1I1.aApr07-unspliced main_exon CDS chr19 15,087,066 15,088,010 +
3UTR chr19 15,088,010 15,088,133 +