Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1J1 Olfactory Receptor

Gene Symbol OR1J11 (View this gene in GeneCards)
Family 1
Subfamily J
Pseudogene No
CORP pseudogene probability score 0.09 (functional)
Aliases OR9-18, hg32, HsOR9.6.1, ORL3232
External Ids HGNC: 8208   GeneBank: AB065716, AF399554, BK004452, NM_001004451   ORDB: ORL3232   
Build #39 labels OR1J1
Chromosomal location 9:122,477,009-122,477,926 (-)
Cluster 9@125
Synteny CLIC#21
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1J2 75.16% 306
OR1J4 74.84% 306

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1J6P 69% 304
Chimp CONTIG771.57-25379 96% 306
Mouse Or1j1 80% 306
Rat Or1j1 81% 306
Cow OR1J25 76% 304
Cow OR1J1 82% 306

Expression evidences

Source Accession
ESTs DB285509
mRNA AB529234
GNF Atlas2 gnf1h10934_at

Sequence information

Nucleotide sequence ATGAGCCCTGAGAACCAGAGCAGCGTGTCCGAGTTCCTCCTCCTGGGCCTCCCCATCCGG
CCAGAGCAGCAGGCCGTGTTCTTCGCCCTGTTCCTGGGCATGTACCTGACCACGGTGCTG
GGGAACCTGCTCATCATGCTGCTCATCCAGCTAGACTCTCACCTTCACACCCCCATGTAC
TTCTTCCTTAGCCACTTGGCCCTCACTGACATCTCCTTTTCATCTGTCACTGTCCCTAAG
ATGCTGATGAACATGCAGACTCAGCACCTAGCCGTCTTTTACAAGGGATGCATTTCACAG
ACATATTTTTTCATATTTTTTGCTGACTTAGACAGTTTCCTTATCACTTCAATGGCATAT
GACAGGTATGTGGCCATCTGTCATCCTCTACATTATGCCACCATCATGACTCAGAGCCAG
TGTGTCATGCTGGTGGCTGGGTCCTGGGTCATCGCTTGTGCGTGTGCTCTTTTGCATACC
CTCCTCCTGGCCCAGCTTTCCTTCTGTGCTGACCACATCATCCCTCACTACTTCTGTGAC
CTTGGTGCCCTGCTCAAGTTGTCCTGCTCAGACACCTCCCTCAATCAGTTAGCAATCTTT
ACAGCAGCATTGACAGCCATTATGCTTCCATTCCTGTGCATCCTGGTTTCTTATGGTCAC
ATTGGGGTCACCATCCTCCAGATTCCCTCTACCAAGGGCATATGCAAAGCCTTGTCCACT
TGTGGATCCCACCTCTCAGTGGTGACTATCTATTATCGGACAATTATTGGTCTCTATTTT
CTTCCCCCATCCAGCAACACCAATGACAAGAACATAATTGCTTCAGTGATATACACAGCA
GTCACTCCCATGTTGAACCCATTCATTTACAGTCTGAGAAATAAAGACATTAAGGGAGCC
CTAAGAAAACTCTTGAGT
Conceptual translation MSPENQSSVSEFLLLGLPIRPEQQAVFFALFLGMYLTTVLGNLLIMLLIQLDSHLHTPMY
FFLSHLALTDISFSSVTVPKMLMNMQTQHLAVFYKGCISQTYFFIFFADLDSFLITSMAY
DRYVAICHPLHYATIMTQSQCVMLVAGSWVIACACALLHTLLLAQLSFCADHIIPHYFCD
LGALLKLSCSDTSLNQLAIFTAALTAIMLPFLCILVSYGHIGVTILQIPSTKGICKALST
CGSHLSVVTIYYRTIIGLYFLPPSSNTNDKNIIASVIYTAVTPMLNPFIYSLRNKDIKGA
LRKLLS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS A/G I/T 1000GP (YRI, YRI, YRI)
9 100 -100 SYN A/G L/L 1000GP (YRI)
9 122,477,222 122,477,222 nonsense SNP G/T C/* 1000GP (CEU)
9 122,477,265 122,477,265 NS A/G I/T 1000GP (CHBJPT)
9 122,477,517 122,477,517 NS G/C T/S 1000GP (CHBJPT)
9 122,477,738 122,477,738 SYN A/G L/L 1000GP (CHBJPT)
9 125,239,501 125,239,501 nonsense SNP G/T C/* rs45579335 (DbSNP)
9 125,239,553 125,239,553 NS C/T C/Y rs45629038 (DbSNP)
9 125,239,796 125,239,796 NS C/G S/T rs73567906 (DbSNP)
9 125,240,017 125,240,017 SYN A/G L/L rs73558876 (DbSNP)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

C235* I221T Y218C H172Y T137S Q23P E11K % Freq CORP
1 C I Y H T Q E 91.63 0.123
2 C T Y H S Q E 3.69 0.123
3 * I Y H T Q E 1.61 1.200
4 C I Y H T Q K 1.15 0.123
5 C T Y H T Q E 0.92 0.123
6 C I Y H T P E 0.46 0.123
7 C I Y H S Q E 0.31 0.123
8 C I Y Y T Q E 0.15 0.123
9 C I C H T Q E 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1J1.aApr07-unspliced main_exon 3UTR chr9 122,476,958 122,477,009 -
CDS chr9 122,477,009 122,477,926 -