Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1J2 Olfactory Receptor

Gene Symbol OR1J21 (View this gene in GeneCards)
Family 1
Subfamily J
Pseudogene No
CORP pseudogene probability score 0.02 (functional)
Aliases HSA5, HSA10, OR9-19, OST044, hg152, HsOR9.6.2, ORL48
External Ids HGNC: 8209   GeneBank: AB065717, AF179760, AF179767, AF399552, AY283941-AY283972, BK004448, HSHTPRX15, NM_054107   ORDB: ORL48   
Build #39 labels OR1J2, OR1J5
Chromosomal location 9:122,510,802-122,511,740 (+)
Cluster 9@125
Synteny CLIC#21
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1J1 75.16% 306
OR1J4 77.88% 312

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1J6P 69% 310
Chimp CONTIG771.57-59256 100% 313
Mouse Or1j4 77% 309
Rat Or1j4 79% 308
Cow OR1J2 85% 311

Expression evidences

Source Accession
mRNA AB528201
GNF Atlas2 gnf1h05925_at

Sequence information

Nucleotide sequence ATGAGCCCTGAGAACCAGAGCAGCGTGTCCGAGTTCCTCCTTCTGGGCCTCCCCATCCGG
CCAGAGCAGCAGGCTGTGTTCTTCACCCTGTTCCTGGGCATGTACCTGACCACGGTGCTG
GGGAACCTGCTCATCATGCTGCTCATCCAGCTGGACTCTCACCTTCACACCCCCATGTAC
TTCTTCCTCAGCCACTTGGCTCTCACTGACATCTCCTTTTCATCTGTCACTGTCCCTAAG
ATGCTGATGGACATGCGGACTAAGTACAAATCGATCCTCTATGAGGAATGCATTTCTCAG
ATGTATTTTTTTATATTTTTTACTGACCTGGACAGCTTCCTTATTACATCAATGGCATAT
GACCGATATGTTGCCATATGTCACCCTCTCCACTACACTGTCATCATGAGGGAAGAGCTC
TGTGTCTTCTTAGTGGCTGTATCTTGGATTCTGTCTTGTGCCAGCTCCCTCTCTCACACC
CTTCTCCTGACCCGGCTGTCTTTCTGTGCTGCGAACACCATCCCCCATGTCTTCTGTGAC
CTTGCTGCCCTGCTCAAGCTGTCCTGCTCAGATATCTTCCTCAATGAGCTGGTCATGTTC
ACAGTAGGGGTGGTGGTCATTACCCTGCCATTCATGTGTATCCTGGTATCATATGGCTAC
ATTGGGGCCACCATCCTGAGGGTCCCTTCAACCAAAGGGATCCACAAAGCATTGTCCACA
TGTGGCTCCCATCTCTCTGTGGTGTCTCTCTATTATGGGTCAATATTTGGCCAGTACCTT
TTCCCGACTGTAAGCAGTTCTATTGACAAGGATGTCATTGTGGCTCTCATGTACACGGTG
GTCACACCCATGTTGAACCCCTTTATCTACAGCCTTAGGAACAGGGACATGAAAGAGGCC
CTTGGGAAACTCTTCAGTAGAGCAACATTTTTCTCTTGG
Conceptual translation MSPENQSSVSEFLLLGLPIRPEQQAVFFTLFLGMYLTTVLGNLLIMLLIQLDSHLHTPMY
FFLSHLALTDISFSSVTVPKMLMDMRTKYKSILYEECISQMYFFIFFTDLDSFLITSMAY
DRYVAICHPLHYTVIMREELCVFLVAVSWILSCASSLSHTLLLTRLSFCAANTIPHVFCD
LAALLKLSCSDIFLNELVMFTVGVVVITLPFMCILVSYGYIGATILRVPSTKGIHKALST
CGSHLSVVSLYYGSIFGQYLFPTVSSSIDKDVIVALMYTVVTPMLNPFIYSLRNRDMKEA
LGKLFSRATFFSW

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS G/A A/T 1000GP (YRI, YRI)
9 100 -100 SYN C/T F/F 1000GP (YRI, YRI)
9 122,511,156 122,511,156 NS G/A A/T 1000GP (CHBJPT)
9 122,511,295 122,511,295 NS G/A R/Q 1000GP (CEU, CHBJPT)
9 122,511,599 122,511,599 NS T/G S/R 1000GP (CEU)
9 125,273,105 125,273,105 NS A/G M/V rs41277118 (DbSNP)
9 125,273,435 125,273,435 NS A/G T/A rs41277120 (DbSNP)
9 125,273,574 125,273,574 NS A/G Q/R rs4836891 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 78 (Hasin)
9 125,272,981 125,276,019 CopyNumber #47 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A25T A119T R165Q T279M % Freq CORP
1 A A R T 76.42 0.098
2 A T R T 12.52 0.141
3 A A Q T 10.14 0.098
4 A A R M 0.69 0.098
5 A A Q M 0.15 0.098
6 T T R T 0.08 0.141

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1J2andOR1Q1.bApr07 exon_5UTR chr9 122,464,025 122,464,749 +
exon_5UTR chr9 122,468,561 122,469,185 +
exon_5UTR chr9 122,475,692 122,475,815 +
exon_5UTR chr9 122,502,778 122,502,870 +
main_exon 5UTR chr9 122,510,789 122,510,802 +
CDS chr9 122,510,802 122,511,740 +
3UTR chr9 122,511,740 122,514,097 +