Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1K1 Olfactory Receptor

Gene Symbol OR1K11 (View this gene in GeneCards)
Family 1
Subfamily K
Pseudogene No
CORP pseudogene probability score 0.69 (pseudogene)
Aliases hg99, HsOR9.6.15, ORL3219
External Ids HGNC: 8212   GeneBank: AB065726, AF399622, NM_080859   ORDB: ORL3219   
Build #39 labels OR1K1
Chromosomal location 9:122,800,123-122,801,070 (+)
Cluster 9@125
Synteny CLIC#21
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1F1 55.34% 309
OR1L4 55.41% 305
OR1L6 54.75% 305

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1K1 90% 316
Chimp CONTIG291.312-2552 95% 262
Mouse Or1af1 55% 301
Rat Or1l4b 55% 300
Cow OR1K1 89% 316

Expression evidences

Source Accession
ESTs AW858627
mRNA AB529306
GNF Atlas2 gnf1h10669_at

Sequence information

Nucleotide sequence ATGGAGGCTGCCAATGAGTCTTCAGAGGGAATCTCATTCGTTTTATTGGGACTGACAACA
AGTCCTGGACAGCAGCGGCCTCTCTTTGTGCTGTTCTTGCTCTTGTATGTGGCCAGCCTC
CTGGGTAATGGACTCATTGTGGCTGCCATCCAGGCCAGTCCAGCCCTTCATGCACCCATG
TACTTCCTGCTGGCCCACCTGTCCTTTGCTGACCTCTGCTTCGCCTCCGTCACTGTGCCC
AAGATGTTGGCCAACTTGTTGGCCCATGACCACTCCATCTCGCTGGCTGGCTGCCTGACC
CAAATGTACTTCTTCTTTGCCCTGGGGGTAACTGATAGCTGTCTTCTGGCGGCCATGGCC
TATGACTGCTACGTGGCCATCCGGCACCCCCTCCCCTATGCCACGAGGATGTCCCGGGCC
ATGTGCGCAGCCCTGGTGGGAATGGCATGGCTGGTGTCCCACGTCCACTCCCTCCTGTAT
ATCCTGCTCATGGCTCGCTTGTCCTTCTGTGCTTCCCACCAAGTGCCCCACTTCTTCTGT
GACCACCAGCCTCTCTTAAGGCTCTCGTGCTCTGACACCCACCACATCCAGCTGCTCATC
TTCACCGAGGGCGCCGCAGTGGTGGTCACTCCCTTCCTGCTCATCCTCGCCTCCTATGGG
GCCATCGCAGCTGCCGTGCTCCAGCTGCCCTCAGCCTCTGGGAGGCTCCGGGCTGTGTCC
ACCTGTGGCTCCCACCTGGCTGTGGTGAGCCTCTTCTATGGGACAGTCATTGCAGTCTAC
TTCCAGGCCACATCCCGACGCGAGGCAGAGTGGGGCCGTGTGGCCACTGTCATGTACACT
GTAGTCACCCCCATGCTGAACCCCATCATCTACAGCCTCTGGAATCGCGATGTACAGGGG
GCACTCCGAGCCCTTCTCATTGGGCGAAGGATCTCAGCTAGTGACTCC
Conceptual translation MEAANESSEGISFVLLGLTTSPGQQRPLFVLFLLLYVASLLGNGLIVAAIQASPALHAPM
YFLLAHLSFADLCFASVTVPKMLANLLAHDHSISLAGCLTQMYFFFALGVTDSCLLAAMA
YDCYVAIRHPLPYATRMSRAMCAALVGMAWLVSHVHSLLYILLMARLSFCASHQVPHFFC
DHQPLLRLSCSDTHHIQLLIFTEGAAVVVTPFLLILASYGAIAAAVLQLPSASGRLRAVS
TCGSHLAVVSLFYGTVIAVYFQATSRREAEWGRVATVMYTVVTPMLNPIIYSLWNRDVQG
ALRALLIGRRISASDS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS G/A R/Q 1000GP (YRI, YRI)
9 100 -100 SYN T/C G/G 1000GP (YRI)
9 122,800,248 122,800,248 SYN T/C G/G 1000GP (CEU, CHBJPT)
9 122,800,372 122,800,372 NS G/A A/T 1000GP (CEU)
9 122,800,924 122,800,924 NS G/A E/K 1000GP (CHBJPT)
9 122,800,933 122,800,933 NS T/C W/R 1000GP (CHBJPT)
9 125,562,527 125,562,527 SYN C/T G/G rs10985782 (DbSNP)
9 125,562,651 125,562,651 NS A/G T/A rs55961642 (DbSNP)
9 125,563,212 125,563,212 NS C/T R/W rs7046603 (DbSNP)
9 125,563,347 125,563,347 NS G/T A/S rs56032401 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
CopyNumber 79 (Hasin)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

A84T A88S M102V R128Q W271R % Freq CORP
1 A A M R W 91.17 0.734
2 A A M R R 6.91 0.734
3 T A M R W 1.31 0.734
4 A A M Q W 0.31 0.734
5 A A V R W 0.15 0.734
6 T A M Q W 0.08 0.734
7 A S M R W 0.08 0.734

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1K1.aApr07-unspliced main_exon CDS chr9 122,800,123 122,801,070 +
3UTR chr9 122,801,070 122,801,073 +