Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1L1 Olfactory Receptor

Gene Symbol OR1L11 (View this gene in GeneCards)
Family 1
Subfamily L
Pseudogene No
CORP pseudogene probability score 0 (functional)
Aliases hRPK-465_F_21, hg23, OR9-27, OR9-C, HsOR9.6.10
External Ids HGNC: 8213   GeneBank: AB065491, BK004230, NM_001005236   
Build #39 labels OR1L1
Chromosomal location 9:122,661,716-122,662,645 (+)
Cluster 9@125
Synteny CLIC#21
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1L3 78.06% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1L8 71% 311
Chimp CONTIG771.75-11577 99% 310
Mouse Or1l8 73% 305
Rat Or1l8 73% 309
Cow OR1L1 91% 310

Expression evidences

Source Accession
mRNA AB463952
GNF Atlas2 gnf1h10922_at

Sequence information

Nucleotide sequence ATGGGAAGAAATAACCTAACAAGACCCTCTGAATTCATCCTCCTTGGACTCTCCTCTCGA
CCTGAGGATCAGAAGCCGCTCTTTGCTGTGTTCCTCCCCATCTACCTTATCACAGTGATA
GGAAACCTGCTTATCATCCTGGCCATCCGCTCAGACACTCGTCTCCAGACGCCCATGTAC
TTCTTTCTAAGCATCCTGTCTTTTGTTGACATTTGCTATGTGACAGTCATTATCCCTAAG
ATGCTGGTGAACTTCTTATCAGAGACAAAGACCATCTCTTACAGTGAGTGTCTGACCCAG
ATGTACTTTTTCTTAGCCTTTGGAAACACAGACAGTTACCTGCTAGCAGCCATGGCCATT
GACCGCTATGTGGCCATATGTAATCCCTTCCACTACATCACCATTATGAGTCACAGATGC
TGTGTCCTGCTTCTGGTTCTCTCCTTCTGCATTCCACATTTTCACTCCCTCCTGCACATT
CTTCTGACTAATCAGCTCATCTTCTGTGCCTCAAATGTCATCCATCACTTTTTCTGCGAT
GATCAACCAGTGCTAAAATTGTCCTGTTCCTCCCATTTTGTCAAAGAAATCACAGTAATG
ACAGAAGGCTTGGCTGTCATAATGACCCCGTTTTCATGCATCATCATCTCTTATTTAAGA
ATCCTCATCACTGTTCTGAAGATTCCTTCAGCTGCTGGAAAGCGTAAAGCATTTTCTACC
TGTGGCTCTCATCTCACAGTGGTGACCCTGTTTTATGGAAGCATTAGCTATCTCTATTTT
CAGCCCCTGTCCAACTATACTGTCAAGGATCAAATAGCAACAATTATCTACACCGTACTG
ACTCCTATGCTAAATCCATTTATCTATAGTCTGAGGAACAAAGACATGAAGCAGGGTTTG
GCAAAGTTGATGCACAGGATGAAATGTCAG
Conceptual translation MGRNNLTRPSEFILLGLSSRPEDQKPLFAVFLPIYLITVIGNLLIILAIRSDTRLQTPMY
FFLSILSFVDICYVTVIIPKMLVNFLSETKTISYSECLTQMYFFLAFGNTDSYLLAAMAI
DRYVAICNPFHYITIMSHRCCVLLLVLSFCIPHFHSLLHILLTNQLIFCASNVIHHFFCD
DQPVLKLSCSSHFVKEITVMTEGLAVIMTPFSCIIISYLRILITVLKIPSAAGKRKAFST
CGSHLTVVTLFYGSISYLYFQPLSNYTVKDQIATIIYTVLTPMLNPFIYSLRNKDMKQGL
AKLMHRMKCQ

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS C/T T/M 1000GP (YRI, YRI, YRI, YRI, YRI, YRI)
9 100 -100 SYN G/C T/T 1000GP (YRI, YRI)
9 122,661,910 122,661,910 NS C/G I/M 1000GP (CHBJPT)
9 122,662,228 122,662,228 SYN A/C S/S 1000GP (CEU, CHBJPT)
9 125,424,189 125,424,189 NS C/G I/M rs73571128 (DbSNP)
9 125,424,277 125,424,277 NS A/G S/G rs70157 (DbSNP)
9 125,424,289 125,424,289 NS A/G T/A rs16912055 (DbSNP)
9 125,424,507 125,424,507 SYN A/C S/S rs70156 (DbSNP)
9 125,424,766 125,424,766 NS C/G L/V rs237620 (DbSNP)
9 125,424,889 125,424,889 NS C/G R/G rs16912062 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
9 125,423,895 125,426,924 CopyNumber #152 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R54H T57M I65M S93F S95G T99A L258V M283T G299R % Freq CORP
1 R T I S S T L M G 79.34 0.013
2 R T M S S T L M G 7.30 0.013
3 R T I S G T V M G 7.14 0.013
4 R T I S G T L M G 2.69 0.013
5 R T I S G A L M G 1.15 0.013
6 R T I S S T L M R 0.84 0.013
7 R M I S G T L M G 0.84 0.013
8 R M I F G T L T G 0.23 0.013
9 H T I S S T L M G 0.23 0.013
10 R M I S S T L M G 0.08 0.013
11 R T I S S T V M G 0.08 0.013
12 R T M S G A L M G 0.08 0.013

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1L1.aApr07-unspliced main_exon 5UTR chr9 122,661,566 122,661,716 +
CDS chr9 122,661,716 122,662,645 +
3UTR chr9 122,662,645 122,662,648 +