Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1L3 Olfactory Receptor

Gene Symbol OR1L31 (View this gene in GeneCards)
Family 1
Subfamily L
Pseudogene No
CORP pseudogene probability score 1 (pseudogene)
Aliases hRPK-465_F_21, OR9-28, OR9-D, HsOR9.6.11, ORL3218
External Ids HGNC: 8215   GeneBank: AB065492, BK004231, NM_001005234   ORDB: ORL3218   
Build #39 labels OR1L3
Chromosomal location 9:122,675,130-122,676,101 (+)
Cluster 9@125
Synteny CLIC#21
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1L1 78.06% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Chimp CONTIG*********** 98% 324
Cow OR1L19 83% 324

Expression evidences

Source Accession
mRNA BC136859
GNF Atlas2 gnf1h10671_at

Sequence information

Nucleotide sequence ATGGGAATGTCCAACCTGACAAGACTCTCTGAATTTATTCTCTTGGGACTCTCCTCTCGG
TCTGAAGACCAGAGGCCACTCTTTGCCCTCTTTCTTATCATATACCTGGTCACTTTGATG
GGAAATCTGCTCATCATCTTGGCTATCCACTCTGATCCTCGACTTCAAAACCCTATGTAT
TTTTTCCTAAGCATCTTGTCCTTTGCTGATATTTGCTACACAACAGTCATAGTCCCAAAG
ATGCTCGTGAACTTCTTATCAGAGAAAAAGACCATTTCCTATGCTGAATGTCTGGCACAG
ATGTATTTCTTCCTGGTTTTTGGAAACATAGATAGTTATCTCCTGGCGGCTATGGCCATC
AACCGCTGTGTAGCCATTTGTAACCCATTCCATTATGTCACTGTTATGAACCGCAGATGC
TGTGTGTTGCTACTAGCATTCCCCATCACTTTCTCCTATTTCCACTCTCTCCTACATGTC
CTCCTGGTGAATCGGCTCACCTTTTGTACATCAAATGTTATCCATCATTTTTTTTGTGAT
GTCAACCCTGTGCTGAAACTGTCCTGCTCCTCCACCTTTGTCAATGAAATTGTGGCCATG
ACAGAAGGGCTGGCCTCTGTGATGGCTCCATTTGTCTGTATCATCATCTCTTATCTAAGA
ATTCTCATCGCTGTTCTCAAGATTCCCTCAGCAGCTGGAAAACACAAAGCCTTCTCCACC
TGCAGCTCCCATCTCACTGTGGTGATTCTGTTTTATGGGAGTATTAGCTATGTCTATTTG
CAGCCTTTGTCCAGCTATACTGTCAAGGACCGAATAGCAACAATCAACTACACTGTGTTG
ACATCAGTGTTGAACCCATTTATCTACAGTTTAAGAAACAAAGACATGAAACGGGGCTTA
CAGAAATTGATAAACAAGATTAAGTCTCAAATGAGTAGGTTCTCTACAAAGACCAATAAA
ATCTGTGGACCC
Conceptual translation MGMSNLTRLSEFILLGLSSRSEDQRPLFALFLIIYLVTLMGNLLIILAIHSDPRLQNPMY
FFLSILSFADICYTTVIVPKMLVNFLSEKKTISYAECLAQMYFFLVFGNIDSYLLAAMAI
NRCVAICNPFHYVTVMNRRCCVLLLAFPITFSYFHSLLHVLLVNRLTFCTSNVIHHFFCD
VNPVLKLSCSSTFVNEIVAMTEGLASVMAPFVCIIISYLRILIAVLKIPSAAGKHKAFST
CSSHLTVVILFYGSISYVYLQPLSSYTVKDRIATINYTVLTSVLNPFIYSLRNKDMKRGL
QKLINKIKSQMSRFSTKTNKICGP

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS G/A R/K 1000GP (YRI, YRI, YRI, YRI, YRI, YRI, YRI)
9 100 -100 SYN T/C Y/Y 1000GP (YRI, YRI)
9 122,675,272 122,675,272 NS C/T A/V 1000GP (CHBJPT)
9 122,675,446 122,675,446 NS T/C V/A 1000GP (CHBJPT)
9 122,675,477 122,675,477 SYN G/A A/A 1000GP (CEU)
9 122,675,490 122,675,490 NS A/G N/D 1000GP (CHBJPT)
9 122,675,937 122,675,937 NS G/T D/Y 1000GP (CEU)
9 122,675,965 122,675,965 NS T/C V/A 1000GP (CHBJPT)
9 122,675,997 122,675,997 NS A/T S/C 1000GP (CEU)
9 122,676,099 122,676,099 NS C/T P/S 1000GP (CHBJPT)
9 125,437,411 125,437,410 Ins(1) -/G rs35421332 (DbSNP)
9 125,437,482 125,437,482 NS A/G K/R rs61100236 (DbSNP)
9 125,437,568 125,437,568 NS C/G R/G rs12379744 (DbSNP)
9 125,437,664 125,437,664 NS G/T V/L rs56304399 (DbSNP)
9 125,437,725 125,437,725 NS C/T A/V rs16912096 (DbSNP)
9 125,437,769 125,437,769 NS A/G N/D rs16912099 (DbSNP)
9 125,437,820 125,437,820 NS C/T R/C rs61480152 (DbSNP)
9 125,438,077 125,438,077 SYN C/T I/I rs16912101 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
9 125,435,804 125,440,267 Inversion Variation_59875 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R25K R54Q I65N F68S L86V V106A N121D R138C R165W L204Q V279A T281I P324S % Freq CORP
1 R R I F L V N R R L V T P 85.41 1.000
2 R R I F L A D R R L A T S 7.45 0.016
3 R R I F L V D R R L V T P 2.76 0.016
4 K R I F L V D C R L V T P 1.38 0.016
5 R R I F L A D R R L V T P 0.54 0.016
6 R R I F V V N R R L V T P 0.46 1.000
7 K R I F L V D R R Q V T P 0.38 0.016
8 K R I F L V D C R Q V T P 0.31 0.016
9 R R I S L V N R R L V T P 0.31 1.000
10 R R I F L A D R R L V T S 0.15 0.016
11 R R I F L V N R W L V T P 0.15 1.000
12 R R N F L V N R R L V T P 0.15 1.000
13 R R I F L V D C R L V T P 0.08 0.016
14 R R I F L V D R W L A T P 0.08 0.016
15 R R I F L A N R R L A T S 0.08 1.000
16 R R I F L V D R R L A T S 0.08 0.016
17 R R I F L A N R R L A T P 0.08 1.000
18 R Q I F L V D R R L V T P 0.08 0.016
19 R R I F L V N R R L V I P 0.08 1.000

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1L3.aApr07-unspliced main_exon CDS chr9 122,675,130 122,676,101 +
3UTR chr9 122,676,101 122,676,104 +