Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1L4 Olfactory Receptor

Gene Symbol OR1L41 (View this gene in GeneCards)
Family 1
Subfamily L
Pseudogene No
CORP pseudogene probability score 0.02 (functional)
Aliases hRPK-465_F_21, OST046, OR9-29, OR9-E, HsOR9.6.12, ORL3244
External Ids HGNC: 8216   GeneBank: AB065724, AF399562, BK004232, NM_001005235   ORDB: ORL3244   
Build #39 labels OR1L4
Chromosomal location 9:122,723,990-122,724,922 (+)
Cluster 9@125
Synteny CLIC#21
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1L6 94.19% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1L6 87% 311
Dog OR1L6BP 87% 311
Chimp CONTIG*********** 96% 311
Chimp CONTIG291.320-3384 95% 310
Mouse Or1l4b 86% 310
Mouse Or1l4 88% 299
Rat Or1l4 86% 311
Rat Or1l4b 87% 305
Cow OR1L6 85% 311
Cow OR1L4 86% 311
Cow OR1L6C 85% 306

Expression evidences

Source Accession
ESTs EG357665
GNF Atlas2 gnf1h10931_at

Sequence information

Nucleotide sequence ATGGAGACAAAGAATTATAGCAGCAGCACCTCAGGCTTCATCCTCCTGGGCCTCTCTTCC
AACCCTAAGCTGCAGAAACCTCTCTTTGCCATCTTCCTCATCATGTACCTACTCACTGCG
GTGGGGAATGTGCTCATCATCCTGGCCATCTACTCTGACCCCAGGCTCCACACCCCTATG
TACTTTTTTCTCAGCAACTTGTCTTTCATGGATATCTGCTTCACAACAGTCATAGTGCCT
AAGATGCTGGTGAATTTTCTATCAGAGACAAAGATTATCTCTTATGTGGGCTGCCTGATC
CAGATGTACTTCTTCATGGCATTTGGGAACACTGACAGCTACCTGCTGGCCTCTATGGCC
ATCGACCGGCTGGTGGCCATCTGCAACCCCTTACACTATGATGTGGTTATGAAACCATGG
CATTGCCTACTCATGCTATTGGGTTCTTGCAGCATCTCCCACCTACATTCCCTGTTCCGC
GTGCTACTTATGTCTCGCTTGTCTTTCTGTGCCTCTCACATCATTAAGCACTTTTTCTGT
GACACCCAGCCTGTGCTAAAGCTCTCCTGCTCTGACACATCCTCCAGCCAGATGGTGGTG
ATGACTGAGACCTTAGCTGTCATTGTGACCCCCTTCCTGTGTACCATCTTCTCCTACCTG
CAAATCATCGTCACTGTGCTCAGAATCCCCTCTGCAGCCGGGAAGTGGAAGGCCTTCTCT
ACCTGTGGCTCCCACCTCACTGTAGTGGTCCTGTTCTATGGGAGTGTCATCTATGTCTAT
TTTAGGCCTCTGTCCATGTACTCAGTGATGAAGGGCCGGGTAGCCACAGTTATGTACACA
GTAGTGACACCCATGCTGAACCCTTTCATCTACAGCCTGAGGAACAAAGATATGAAAAGG
GGTTTGAAGAAATTAAGACACAGAATTTACTCA
Conceptual translation METKNYSSSTSGFILLGLSSNPKLQKPLFAIFLIMYLLTAVGNVLIILAIYSDPRLHTPM
YFFLSNLSFMDICFTTVIVPKMLVNFLSETKIISYVGCLIQMYFFMAFGNTDSYLLASMA
IDRLVAICNPLHYDVVMKPWHCLLMLLGSCSISHLHSLFRVLLMSRLSFCASHIIKHFFC
DTQPVLKLSCSDTSSSQMVVMTETLAVIVTPFLCTIFSYLQIIVTVLRIPSAAGKWKAFS
TCGSHLTVVVLFYGSVIYVYFRPLSMYSVMKGRVATVMYTVVTPMLNPFIYSLRNKDMKR
GLKKLRHRIYS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS C/T T/I 1000GP (YRI, YRI)
9 122,724,757 122,724,757 SYN C/T V/V 1000GP (CHBJPT)
9 125,486,335 125,486,335 NS A/C K/Q rs58159408 (DbSNP)
9 125,486,446 125,486,446 NS A/G M/V rs41316502 (DbSNP)
9 125,486,968 125,486,968 NS A/G R/G rs2215530 (DbSNP)
9 125,487,196 125,487,196 NS C/T H/Y rs12341025 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
9 125,486,953 125,514,075 CopyNumber Variation_100776 (DGV)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

T3I P22S K23Q W140R H141Y Y310H % Freq CORP
1 T P K W H Y 97.08 0.079
2 T P K R H Y 1.38 0.079
3 T S K W H Y 0.54 0.079
4 T P K W H H 0.54 0.079
5 T P Q W H Y 0.23 0.079
6 T P K W Y Y 0.15 0.079
7 I P K W H Y 0.08 0.079

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1L4.aApr07-unspliced main_exon CDS chr9 122,723,990 122,724,922 +
3UTR chr9 122,724,922 122,724,925 +