Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1L6 Olfactory Receptor

Gene Symbol OR1L61 (View this gene in GeneCards)
Family 1
Subfamily L
Pseudogene No
CORP pseudogene probability score 0.02 (functional)
Aliases OR9-30, HShRPK-465_F_21, hg16, HsOR9.6.13, ORL3219
External Ids HGNC: 8218   GeneBank: AB065727, AF399563, BK004234, NM_001004453   ORDB: ORL3219   
Build #39 labels OR1L6
Chromosomal location 9:122,749,848-122,750,780 (+)
Cluster 9@125
Synteny CLIC#21
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1L4 94.19% 310

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1L6 87% 310
Dog OR1L6BP 87% 310
Chimp CONTIG291.320-3384 96% 311
Chimp CONTIG*********** 95% 310
Mouse Or1l4b 86% 307
Mouse Or1l4 88% 298
Rat Or1l4 87% 310
Rat Or1l4b 87% 304
Cow OR1L6 85% 310
Cow OR1L4 85% 310
Cow OR1L6C 84% 307

Expression evidences

Source Accession
mRNA AB529307
GNF Atlas2 gnf1h10670_at

Sequence information

Nucleotide sequence ATGGAGATAAAGAACTACAGCAGCAGCACCTCAGGCTTCATCCTCCTGGGCCTCTCTTCC
AACCCTCAGCTGCAGAAACCTCTCTTTGCCATCTTCCTCATCATGTACCTGCTCGCTGCG
GTGGGGAATGTGCTCATCATCCCGGCCATCTACTCTGACCCCAGGCTCCACACCCCTATG
TACTTTTTTCTCAGCAACTTGTCTTTCATGGATATCTGCTTCACAACAGTCATAGTGCCT
AAGATGCTGGTGAATTTTCTATCAGAGACAAAGGTTATCTCCTATGTGGGCTGCCTGGCC
CAGATGTACTTCTTTATGGCATTTGGGAACACTGACAGCTACCTGCTGGCCTCTATGGCC
ATCGACCGGCTGGTGGCCATCTGCAACCCCTTACACTATGATGTGGTTATGAAACCACGG
CATTGCCTGCTCATGCTATTGGGTTCTTGCAGCATCTCCCACCTACATTCCCTGTTCCGC
GTGCTACTTATGTCTCGCTTGTCTTTCTGTGCCTCTCACATCATTAAGCACTTTTTCTGT
GACACCCAGCCTGTGCTAAAGCTCTCCTGCTCTGACACATCCTCCAGCCAGATGGTGGTG
ATGACTGAGACCTTAGCTGTCATTGTGACCCCCTTCCTGTGTATCATCTTCTCCTACCTG
CGAATCATGGTCACTGTGCTCAGAATCCCCTCTGCAGCCGGGAAGTGGAAGGCCTTCTCT
ACCTGTGGCTCCCACCTCACTGCAGTAGCCCTTTTCTATGGGAGTATTATTTATGTCTAT
TTTAGGCCCCTGTCCATGTACTCAGTGGTTAGGGACCGGGTAGCCACAGTTATGTACACA
GTAGTGACACCCATGCTGAACCCTTTCATCTACAGCCTGAGGAACAAAGATATGAAGAGG
GGTTTGAAGAAATTACAGGACAGAATTTACCGG
Conceptual translation MEIKNYSSSTSGFILLGLSSNPQLQKPLFAIFLIMYLLAAVGNVLIIPAIYSDPRLHTPM
YFFLSNLSFMDICFTTVIVPKMLVNFLSETKVISYVGCLAQMYFFMAFGNTDSYLLASMA
IDRLVAICNPLHYDVVMKPRHCLLMLLGSCSISHLHSLFRVLLMSRLSFCASHIIKHFFC
DTQPVLKLSCSDTSSSQMVVMTETLAVIVTPFLCIIFSYLRIMVTVLRIPSAAGKWKAFS
TCGSHLTAVALFYGSIIYVYFRPLSMYSVVRDRVATVMYTVVTPMLNPFIYSLRNKDMKR
GLKKLQDRIYR

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS C/T A/V 1000GP (YRI, YRI, YRI, YRI)
9 122,749,914 122,749,914 NS C/A Q/K 1000GP (CEU)
9 122,750,159 122,750,159 NS C/G F/L 1000GP (CEU)
9 122,750,491 122,750,491 NS T/C I/T 1000GP (CEU)
9 122,750,509 122,750,509 NS G/A R/Q 1000GP (CEU)
9 122,750,516 122,750,516 NS G/C M/I 1000GP (CEU)
9 122,750,664 122,750,664 NS C/T R/W 1000GP (CEU)
9 125,512,193 125,512,193 NS A/C K/Q rs10760252 (DbSNP)
9 125,512,245 125,512,245 NS C/T A/V rs73571194 (DbSNP)
9 125,512,408 125,512,408 SYN C/T S/S rs41309328 (DbSNP)
9 125,512,575 125,512,575 NS A/G Y/C rs4838012 (DbSNP)
9 125,512,770 125,512,770 NS C/T T/I rs10985760 (DbSNP)
9 125,512,795 125,512,795 NS C/G I/M rs10818741 (DbSNP)
9 125,512,826 125,512,826 NS A/G R/G rs28670025 (DbSNP)
9 125,512,855 125,512,855 SYN C/T G/G rs10985761 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
9 125,486,953 125,514,075 CopyNumber Variation_100776 (DGV)
9 125,512,027 125,515,059 CopyNumber #49 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

Q23K A40V M102T F104L C150Y I215T R221Q M223I G234R R273W % Freq CORP
1 K A M F Y T Q I R R 82.64 0.065
2 Q A M F C I R M G R 6.22 0.079
3 K A M F Y I R M R R 2.46 0.065
4 K A M F Y T R M R R 2.00 0.065
5 K V M F Y T Q I R R 1.69 0.065
6 Q A M L C I R M G R 1.46 0.079
7 K A M F C I R M G R 0.92 0.079
8 K A M F Y T Q I R W 0.54 0.065
9 K A M F Y T R I R R 0.46 0.065
10 K V M F Y I R M R R 0.38 0.065
11 K A M F Y I R I R R 0.23 0.065
12 K A M F Y I Q I R R 0.15 0.065
13 Q A M F Y I R M G R 0.15 0.079
14 Q A M F Y T Q I R R 0.08 0.065
15 Q A M L Y I R M G R 0.08 0.079
16 K A M F Y T Q I G R 0.08 0.079
17 K A M L C I R M G R 0.08 0.079
18 K V M F Y T R M R R 0.08 0.065
19 Q A M F C I R M G W 0.08 0.079
20 Q A M L C T R I R R 0.08 0.065
21 K A T F Y T Q I R R 0.08 0.065
22 K A M F Y I R M G R 0.08 0.079

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1L6.aApr07-unspliced main_exon 5UTR chr9 122,749,740 122,749,848 +
CDS chr9 122,749,848 122,750,780 +
3UTR chr9 122,750,780 122,750,783 +