Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

OR1L8 Olfactory Receptor

Gene Symbol OR1L81 (View this gene in GeneCards)
Family 1
Subfamily L
Pseudogene No
CORP pseudogene probability score 0.01 (functional)
Aliases OR9-24, HsOR9.6.6, ORL3216
External Ids HGNC: 15110   GeneBank: AB065721, AF399564, BK004447, NM_001004454   ORDB: ORL3216   
Build #39 labels OR1L8
Chromosomal location 9:122,567,551-122,568,477 (-)
Cluster 9@125
Synteny CLIC#21
Remarks

Most Similar ORs in Humans (Paralogs)

Symbol Percent Length
OR1L1 69.64% 303
OR1L3 68.42% 304

Most Similar ORs in other species (Orthologs)

Specie Symbol Percent Length
Dog OR1L8 80% 307
Chimp CONTIG771.62-15030 95% 309
Mouse Or1l8 85% 308
Rat Or1l8 84% 308
Cow OR1L23 80% 308
Cow OR1L8 81% 308
Cow OR1L8D 84% 308
Cow OR1L8C 81% 308
Cow OR1L8BP 83% 308

Expression evidences

Source Accession
mRNA AB529308
GNF Atlas2 gnf1h10933_at

Sequence information

Nucleotide sequence ATGGAAAGAATCAACCACACCAGCAGTGTCTCCGAGTTTATCCTCCTGGGACTCTCCTCC
CGGCCTGAGGACCAAAAGACACTCTTTGTTCTCTTCCTCATCGTGTACCTGGTCACCATA
ACAGGGAACCTGCTCATCATCCTGGCCATTCGCTTCAACCCCCATCTTCAGACCCCTATG
TATTTCTTCTTGAGTTTTCTGTCTCTCACTGATATTTGCTTTACAACAAGCGTTGTCCCC
AAGATGCTGATGAACTTCCTGTCAGAAAAGAAGACCATCTCCTATGCTGGGTGTCTGACA
CAGATGTATTTTCTCTATGCCTTGGGCAACAGTGACAGCTGCCTTCTGGCAGTCATGGCC
TTTGACCGCTATGTGGCCGTCTGTGACCCTTTCCACTATGTCACCACCATGAGCCACCAC
CACTGTGTCCTGCTGGTGGCCTTCTCCTGCTCATTTCCTCACCTCCACTCACTCCTGCAC
ACACTTCTGCTGAATCGTCTCACCTTCTGTGACTCCAATGTTATCCACCACTTTCTCTGT
GACCTCAGCCCTGTGCTGAAATTGTCCTGCTCTTCCATATTTGTCAATGAAATTGTGCAG
ATGACAGAAGCACCTATTGTTTTGGTGACTCGTTTTCTCTGCATTGCTTTCTCTTATATA
CGAATCCTCACTACAGTTCTCAAGATTCCCTCTACTTCTGGGAAACGCAAAGCCTTCTCC
ACCTGTGGTTTTTACCTCACCGTGGTGACGCTCTTTTATGGAAGCATCTTCTGTGTCTAT
TTACAGCCCCCATCCACCTACGCTGTCAAGGACCACGTGGCAACAATTGTTTACACAGTT
TTGTCATCCATGCTCAATCCTTTTATCTACAGCCTGAGAAACAAAGACCTGAAACAGGGC
CTGAGGAAGCTTATGAGCAAGAGATCC
Conceptual translation MERINHTSSVSEFILLGLSSRPEDQKTLFVLFLIVYLVTITGNLLIILAIRFNPHLQTPM
YFFLSFLSLTDICFTTSVVPKMLMNFLSEKKTISYAGCLTQMYFLYALGNSDSCLLAVMA
FDRYVAVCDPFHYVTTMSHHHCVLLVAFSCSFPHLHSLLHTLLLNRLTFCDSNVIHHFLC
DLSPVLKLSCSSIFVNEIVQMTEAPIVLVTRFLCIAFSYIRILTTVLKIPSTSGKRKAFS
TCGFYLTVVTLFYGSIFCVYLQPPSTYAVKDHVATIVYTVLSSMLNPFIYSLRNKDLKQG
LRKLMSKRS

Protein domains and features

Variations - SNPs

Chr Start End Type Variation AA Change SNP IDs
9 100 -100 NS C/G R/P 1000GP (YRI, YRI, YRI, YRI)
9 100 -100 SYN A/C S/S 1000GP (YRI, YRI, YRI)
9 122,567,659 122,567,659 SYN C/T V/V 1000GP (CEU)
9 122,567,742 122,567,742 NS G/A L/F 1000GP (CEU)
9 122,567,846 122,567,846 NS C/G R/P 1000GP (CEU, CHBJPT)
9 122,567,905 122,567,905 SYN A/C S/S 1000GP (CEU, CHBJPT)
9 122,568,046 122,568,046 SYN C/G L/L 1000GP (CEU, CHBJPT)
9 122,568,399 122,568,399 NS T/G T/P 1000GP (CEU)
9 122,568,460 122,568,460 SYN G/A H/H 1000GP (CEU, CHBJPT)
9 122,568,470 122,568,470 NS C/A R/I 1000GP (CHBJPT)
9 125,330,125 125,330,125 NS C/G R/P rs10739614 (DbSNP)
9 125,330,184 125,330,184 SYN A/C S/S rs10985702 (DbSNP)
9 125,330,240 125,330,240 NS G/T H/N rs72751258 (DbSNP)
9 125,330,275 125,330,275 NS G/T T/K rs62621011 (DbSNP)
9 125,330,325 125,330,325 SYN C/G L/L rs10985703 (DbSNP)
9 125,330,678 125,330,678 NS G/T P/T rs10985704 (DbSNP)
9 125,330,724 125,330,724 SYN A/G S/S rs41305505 (DbSNP)
9 125,330,739 125,330,739 SYN A/G H/H rs1999182 (DbSNP)

Variations - CNVs

Chr Start End Type Sources
9 125,327,830 125,330,856 CopyNumber #116 (Waszak)

Haplotypes

Protein haplotypes were calculated using the 1000 genomes project as described in Olender T. et. al. BMC Genomics 2012.

R221* R211P N173S N173H R51C T27P L15F R3I % Freq CORP
1 R P N N R P L R 63.36 0.052
2 R R N N R T L R 25.04 0.024
3 R P N N R T L R 6.22 0.052
4 R P N N R P F R 2.38 0.052
5 R P N H R P L R 0.77 0.052
6 R P N N R P L I 0.69 0.052
7 R P S N R P L R 0.54 0.052
8 R R N N C T L R 0.46 0.024
9 R R N N R P L R 0.31 0.024
10 * P N N R P L R 0.23 1.200

AceView Gene Models

The information is based on AceView gene models, constructed from cDNA sequences. The information might be incomplete.

Accession Type Chr Start End Strand
OR1L8.aApr07-unspliced main_exon 3UTR chr9 122,567,548 122,567,551 -
CDS chr9 122,567,551 122,568,477 -